KEGG   Ralstonia pickettii 12D: Rpic12D_0717
Entry
Rpic12D_0717      CDS       T00925                                 

Definition
(GenBank) Tfp pilus assembly protein tip-associated adhesin PilY1-like protein
  KO
K02674  type IV pilus assembly protein PilY1
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0717
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0717
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0717
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0717
SSDB
Motif
Pfam: Neisseria_PilC PQQ EF-hand_5 EF-hand_1 FG-GAP
Other DBs
NCBI-ProteinID: ACS62018
UniProt: C6BE58
Position
1:748616..751984
AA seq 1122 aa
MKTPSPLVKALALLISSLLPLTTNAALLTIAQYPLFLSSNTATPNILVVYDNSQSMDGTM
AGKLIAGNDPTTRGNIARSVITSTISNYRTQFNWGLATFDAPGPSLYNTYAYFFGSANTM
VFTNDCVNGISASNGGLRCVPNPQSGASYSYLTYELSGDDPAINDVLYYNGTWPYPWAIG
LSGGTTSNPNTNYNGCQNHANVSTWNSGDFSGCQQVGFTPTDAGFLPGNPPYSRMIWLSR
AWGYYANISGAGKMLEAVQADSPSHYQNLIDYLAPETNSNSAASGHSKLEIKNGAVATPL
SGSLQTARSYFAGSQTGYSTPVTQSCQKNFVLLATDGNPTGKTDGSMWALSDQQSTYNSS
TGQWTFSNAANDVFSQITALRSTSVKGYTSPFDIQTYVVGMGSTVSNPASVAALNQMAKL
GGTGNAYLSTDPATLQQQFQSIAADITTKVAAASAVSLNAGSWGSGTALYQAKFSSADWS
GQLLAYAINSDGSIGSQLWDAGQQINSQNWDTGRQILTYKPSAALGSRGIPFRWPVSPGS
PKATEMDAAQSTKLNYNASQTTNDGYGSQRVTYLRGNNANEANTCGSCTPSFRNRPTSKL
GDIIHSSPNYVGAPAFNYPDNMESAPYSAFVSTWRNRTPMIYVGANDGMLHGINASTGKE
SMAYVPAAIYSNLSMLTAPTYTHQYFADGSVTVGDTFYKSGWHTLLSGALAGGGQGIFAL
DVTDPSKFTESTASQVARWEFTDANDADMGYSFGQPLIVKTNNGRWSVIVANGYNSTQSD
GAASTTGHAVLFVLDAETGAVTAKIDTNAGTTAAPNGLSGPVAVDTNGDGIADVVYAGDL
AGNMWKFDLSSSTVSNWGVAFGTSGSPQPLFSTGGQPITVRPDVTRNLQGNYLLVFGTGQ
YFTTTDTTSTAGQTFYGIIDKGATISGLSNLQQQSVLGTTTGPDGNTYRITTHAVGAPTL
DALRSGDNAISLGSYNSSKLGWYINLPTTGERAVTDATIRSGRVIFNTVIPSTAQCSAGG
TGWVMELDVFTGNRLDSPTFDTNGDGVINNSDLLQYGGSSANTSGRQVGSIPAAPGFLQP
IQAPGASPFENKYVNTSAGAIQVIGETAGKGSRGRVAWRQLN
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgaagacaccatctcccctagtcaaggcgctcgcgctattgatcagctcgctgctgccg
ctgacgactaacgcggctctgctaaccatcgcgcaatatccgctgtttctgtcgagcaac
acagccacgcccaatattttggtggtctatgacaactcgcagtccatggacggaacgatg
gcgggtaagttgatcgcgggcaacgatccgaccacacgtggcaacattgcgcgctcggtg
attacgtcgaccatctcgaactatcgcacccaattcaactggggcctagcgacgttcgat
gcaccgggccccagcctgtacaacacgtatgcctacttctttgggagcgccaacaccatg
gtgttcacaaatgactgtgtcaacggcatttccgcatcgaacggcggcctgcgctgcgtc
ccgaatccgcaatcgggtgcctcgtattcgtatttgacttacgagctcagtggcgatgat
cctgccatcaacgacgtcttgtactacaacggtacgtggccgtatccgtgggctattggc
ttatcaggggggacaaccagcaatcccaataccaattacaacgggtgccagaaccacgcc
aacgtgtcgacctggaattccggtgacttctcgggttgccagcaagttggctttacgccg
accgacgccgggtttctgccgggcaaccctccttactcacgaatgatctggctatcgcgt
gcgtggggctactacgccaacataagcggggccggaaaaatgctggaagctgtgcaggcg
gattcgccctcgcattaccagaatctgatcgattatctggcgccggagacaaactcaaat
tcagcagcgagcggccacagcaagctcgaaatcaagaacggggcggtggctacgcctctc
tctggcagtctgcaaacggcgaggagttacttcgcgggctcgcagactggctattcgacg
cctgtgactcaaagttgccagaagaactttgtgctgttagccaccgatggcaaccccacc
ggcaagaccgatggttcgatgtgggcgctttccgatcagcaaagcacctataactcgagc
actggacagtggacgttctccaacgccgcgaacgatgtgttcagtcaaatcacggcgtta
cgcagtacgagcgttaagggttatacgagtccctttgacattcagacctacgtggtcggg
atgggtagcacggtgtccaacccggcttcggtagctgcgctcaaccaaatggcgaagctc
ggggggacgggcaatgcttacctgagcacggatcccgcaaccctgcagcagcagttccag
agcatcgcggcggacattaccaccaaggtggcagcggcttcagccgtttccctgaacgcg
ggttcctgggggtcaggcactgccttgtaccaggccaagttcagcagcgcggactggtcg
ggccagttgcttgcatatgccattaactcggacggttcgatcggtagccaactctgggat
gccggccagcagatcaattcacagaactgggataccgggcgccagatcctgacgtacaag
ccgtctgcggctcttgggtctcgcggtattccgttccgatggcctgtatcgccgggttcg
ccgaaggcaaccgagatggacgcggcgcaatcgaccaagctgaactacaacgccagccag
accaccaacgatggctatggctcgcagcgtgtgacctatctgcgtggcaacaatgccaac
gaagccaatacttgtgggtcctgcacaccttcgtttcgcaatcgtccgacgagcaagctg
ggcgacatcattcactcatcgccgaactatgtcggcgcgcctgcgttcaactatccagac
aacatggagagcgccccttactccgcattcgtatcgacttggcgcaatcgaacgccgatg
atctacgtcggagccaatgacggcatgctgcacggcatcaatgcgtctacagggaaagag
tcgatggcctatgttccggcggccatctacagcaacctcagtatgctgaccgctccgacc
tacacacaccagtacttcgcggacggctccgtcacggtgggggacaccttctataagagc
gggtggcatacgttgctgtcaggcgcgctggccggtggaggacagggcattttcgcgctc
gacgtcaccgatccgtcgaagttcaccgagtcgactgcgagccaggtcgcgcgctgggaa
ttcaccgacgcgaatgacgcagacatgggctatagctttggtcaaccgttgatcgtcaaa
acaaacaacggaaggtggtccgttattgtggccaatggttacaacagcacgcagtctgat
ggtgcggcgagcacgaccggccacgcagtgctgtttgtgttggatgctgaaaccggagcg
gtcactgcaaagattgatacgaacgctggcactactgctgcgccaaatggcctgtcagga
cctgtcgcagttgataccaacggggatggcattgccgacgttgtttatgccggagatctg
gcgggcaacatgtggaagttcgacctgtcgagcagcacggtcagcaattggggggttgca
tttggtacctccggcagtccgcagcctttgttcagtacgggggggcagccgattacggta
cgcccggacgtgactcgaaatttgcaaggtaactacctcctggtctttggcacggggcag
tacttcacaacgaccgatacaacctcgacggctggacagaccttctacggcatcatcgac
aagggcgccacgatcagcggcctgtctaatctacagcagcaatcggtgttgggcacaaca
acgggtcccgacggcaacacgtatcgcatcacgacacacgccgtaggagcgccaaccttg
gacgcgcttcggtccggcgacaatgcaatttcacttgggtcctacaacagctcgaagctc
ggttggtacatcaacttgccgactaccggagagcgtgctgtgacagatgcgactattcgt
tcgggtcgtgtgatttttaacactgtcatcccgtccaccgcccaatgcagcgccggtggt
accggctgggtgatggagctggatgtctttacgggcaaccgtctggatagtccgaccttc
gataccaatggcgatggagtcatcaacaactcggatctactccaatatggcggttcgtcc
gccaatacgagtggtcgacaagtcggctcgattcccgctgctccgggctttttgcagcct
attcaagcaccgggcgcctcgccatttgaaaacaaatacgtcaatacttcggcgggtgcc
attcaagtgatcggtgaaacggcaggtaagggttcccgtggccgtgttgcatggcggcaa
ttgaactga

DBGET integrated database retrieval system