KEGG   Ralstonia pickettii 12D: Rpic12D_0718
Entry
Rpic12D_0718      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62019
UniProt: C6BE59
Position
1:751996..752355
AA seq 119 aa
MKKLYVIATFVLAGNAAYGALAVGGGEPGGVTLSPASSRAQPHASEAPRMLRGVVTALNL
DKGEIDVHGNRLQVGRAVRVFGPAGDTSRLSSLRLGQEIRFLLDPKDASERTISVIYFQ
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaagaagctgtatgtgattgccacctttgtgctggcaggcaatgcagcatatggggcg
ctggcggtgggaggtggcgagcctggcggcgtgacgctcagcccggcgtcgagtcgggcg
cagccccatgcgagtgaagcacctcgcatgctacgtggcgtggtcaccgcgctcaatctg
gataaaggtgagattgacgtgcacggtaatcgccttcaggtcggtcgtgcggtgcgcgta
tttggccccgctggggatacgagccgcctctcgtcgttgcgtctggggcaagagattcgt
ttcctgctggatccaaaggacgcctctgagcggacgatttcagttatctacttccaatga

DBGET integrated database retrieval system