KEGG   Ralstonia pickettii 12D: Rpic12D_0719
Entry
Rpic12D_0719      CDS       T00925                                 

Definition
(GenBank) type IV pilin
  KO
K02655  type IV pilus assembly protein PilE
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0719
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0719
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0719
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0719
SSDB
Motif
Pfam: ComP_DUS N_methyl SdrD_B DHO_dh
Other DBs
NCBI-ProteinID: ACS62020
UniProt: C6BE60
Position
1:752352..752786
AA seq 144 aa
MNTGLSRSRRLPRGFTLVELMITVAIVGILAVVAYPSLNGYIQKSRRADAKTALLAVAQK
MEQYRSLGNTYAGATLGASGVYANTKSDNGYYALSFSVVPTQTVYTIQAVPQAGQATDAC
GTFSYDQAGNKMVSGGTLTASSCW
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaacacaggactctctcgctctcggcgtttgccccgcggcttcacattggttgagctg
atgatcacggtcgctattgtgggcatcctcgccgttgtggcgtatccgtcgctcaacggc
tacatacaaaagtccaggcgcgcggatgccaaaacggcgttgctcgcggtggctcagaaa
atggagcaataccgctcattgggcaacacctacgctggcgcgacattgggcgccagcggc
gtttacgccaataccaagtcagacaacggctactacgctctgagtttctctgtcgtgcct
acacagacggtctatacgattcaagccgttccgcaggccggtcaggcaacggatgcatgc
ggtaccttcagctacgatcaggcggggaataaaatggtatccgggggcacgcttacggca
tcaagttgctggtag

DBGET integrated database retrieval system