KEGG   Ralstonia pickettii 12D: Rpic12D_0720
Entry
Rpic12D_0720      CDS       T00925                                 

Definition
(GenBank) transposase mutator type
  KO
K07493  putative transposase
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Rpic12D_0720
SSDB
Motif
Pfam: Transposase_mut MULE
Other DBs
NCBI-ProteinID: ACS62021
UniProt: C6BBF0
Position
1:complement(752879..754129)
AA seq 416 aa
MPRKPKAKPADLPAIPAELLEQFGSGPMTAEAINAATLALKKALIERALGGEMNHHLGYP
PGASKPATVSNQRNGTGAKTVLTEGGPIRIEVPRDRDGSFAPLLIPKHERRFKGFDDKIV
AMYARGMTVREIQGFLLEQYATDVSPEFISSVTDEVMAEVTAWQARPLDPMYPVVFFDAL
RVKIREDAVVRNKAVYLALGVLPDGTRDILGLWIENTEGAKFWMKVFNDLKTRGVNDILI
AVTDGLKGMPEALAAVFPATTLQTCIVHLIRNSLDYASWKDRRALAAAIRPIYTAPSAEA
AQAELEAFADGPWGQRYPTVSAAWRNAWDRVIPFFAFPPAVRKVIYTTNAIENINAQLRK
IIKTRGHFPSDEAATKLIWLALRNITAGWSRAAHDWKQAMNQFAILYADRFVRPSV
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgccacgcaaaccgaaagccaagccggcggacctgccggcgatccctgccgaactgctt
gagcagttcggcagcggcccgatgacggccgaagccatcaacgcggcgaccctggccctc
aagaaggccctgatcgaacgggcgctgggcggcgagatgaatcaccatctgggctacccg
ccaggtgcgtccaagccggccacggtgagcaatcagcgcaacggcacgggcgccaagacg
gtgctgaccgagggcggcccgatccgcatcgaggtaccgcgcgaccgtgacggcagcttc
gcgccgctgctcatccccaaacacgaacgacgcttcaagggcttcgacgacaagatcgtc
gccatgtatgcccggggcatgaccgtgcgcgagatccagggcttcctgctggagcaatat
gcgacggacgtctcgcctgagttcatcagctcggtcaccgacgaggtgatggccgaagtc
accgcctggcaggcccggccgctcgatcccatgtacccggtggtgttcttcgacgcgctg
cgggtcaagatccgggaggatgccgtggtgcgcaacaaggccgtctatctggcgctgggg
gttctgcccgacggcacgcgtgacatcctgggcctgtggatcgagaacaccgagggtgcc
aagttctggatgaaggtgttcaacgatctcaagacgcgcggcgtgaacgacatcctgatc
gccgtgaccgacggcctcaagggcatgcccgaggcgctggcagctgtgttccccgcgacc
acgctgcagacctgcatcgtccacctgatccgcaacagcctcgattacgcgagctggaag
gaccgtcgtgcgctggcggccgcgatcaggccgatctacacagccccgagcgcagaggcc
gcgcaggccgagcttgaggcgtttgccgacggcccgtgggggcagcgataccccaccgtc
agtgccgcctggcgcaacgcctgggatcgcgtgattccgttctttgcgttcccgccggcg
gtacgcaaggtgatttacacgacgaacgccatcgagaacatcaacgcccaactacgcaag
atcatcaagacccgtggccacttcccgagcgacgaagcagcaacaaaactcatctggctg
gcactgcgcaacatcacggccggttggagccgtgccgctcacgactggaagcaggcgatg
aaccagttcgctatcctctacgcggatcgattcgttcgaccgtccgtgtga

DBGET integrated database retrieval system