KEGG   Ralstonia pickettii 12D: Rpic12D_0721
Entry
Rpic12D_0721      CDS       T00925                                 

Definition
(GenBank) ATP-cone domain protein
  KO
K07738  transcriptional repressor NrdR
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rpf03000]
    Rpic12D_0721
Transcription factors [BR:rpf03000]
 Prokaryotic type
  Other transcription factors
   Others
    Rpic12D_0721
SSDB
Motif
Pfam: ATP-cone Zn_Tnp_IS1595 Elf1 Lar_restr_allev Cys_rich_CPXG Nre_C zf-ZPR1 TF_Zn_Ribbon DUF3268 DiS_P_DiS TFIIS_C
Other DBs
NCBI-ProteinID: ACS62022
UniProt: C6BE62
Position
1:complement(754184..754648)
AA seq 154 aa
MKCPFCGHAATQVIDTRMSEEGDTVRRRRRCESCDRRFTTYERIELFFPAVVKKNGSRVD
YDRNKVKDSMRLALRKRPVSAEAIDEAIARIEEKLLSHGEKEIGSDRVGELVMRELKRLD
KIGYIRFASVYRSFEDLAEFRDVLDEVAATNVRK
NT seq 465 nt   +upstreamnt  +downstreamnt
atgaaatgccccttttgcggccacgcggccacccaggtgattgatacccgcatgtcggaa
gaaggcgacaccgtgcgccgccgccgtcgctgcgaatcctgcgaccgccgctttaccacc
tacgaacgcatcgagctgttcttccctgccgtcgtcaaaaagaacggcagccgtgtcgac
tacgaccgcaacaaggtcaaggattccatgcgcctggcgctgcgcaagcgtcccgtgtcc
gccgaggccatcgacgaggccatcgcccgcatcgaagaaaaactcctcagccacggcgaa
aaagaaatcggcagcgaccgcgtgggcgaactggtgatgcgggaactcaagcggctggac
aagatcgggtacatccgctttgcgtcggtgtaccggagttttgaggatctggcagagttt
cgggacgtgctggatgaggttgcggcgacgaatgtgcggaaatag

DBGET integrated database retrieval system