KEGG   Ralstonia pickettii 12D: Rpic12D_0722
Entry
Rpic12D_0722      CDS       T00925                                 

Definition
(GenBank) Glycine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00260  Glycine, serine and threonine metabolism
rpf00460  Cyanoamino acid metabolism
rpf00630  Glyoxylate and dicarboxylate metabolism
rpf00670  One carbon pool by folate
rpf00680  Methane metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01200  Carbon metabolism
rpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_0722
  09102 Energy metabolism
   00680 Methane metabolism
    Rpic12D_0722
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic12D_0722
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Rpic12D_0722
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rpic12D_0722
Enzymes [BR:rpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     Rpic12D_0722
SSDB
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP OKR_DC_1 Met_gamma_lyase
Other DBs
NCBI-ProteinID: ACS62023
UniProt: C6BE63
Position
1:complement(754783..756093)
AA seq 436 aa
MFPHASPDLRHFRFVSDQTLAMFERSRYTIDQIDAEIFAAIQQENQRQEDHIELIASENY
TSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSG
SQANQGVFFAVLKPGDTIMGMSLAEGGHLTHGMALNMSGKWFNVVSYGLNAQEDIDYDAL
EALAQEKKPKLIIAGASAFALRIDFERIGKIAKSIGAYFMVDMAHYAGLIAAGVYPNPVP
HADFVTTTTHKSLRGPRGGVILMKAEHEKAINSAIFPGIQGGPLMHVIAGKAVAFKEALS
PEFKAYQQQVVKNAAVMAETLMARGLRIVSGRTESHVMLVDLRAKKITGKEAEKVLGDAH
ITVNKNAIPNDPEKPFVTSGVRLGSPAMTTRGFKEAEAVKVAHLIADVLDNPHDEANIAA
VRAKVAELTKQFPVYG
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgtttccccacgcctcgcccgatctccgccatttccgtttcgtttcagaccagacactc
gccatgttcgaacgcagccgctatacgatcgaccagatcgatgccgaaatcttcgccgcc
atccagcaggaaaatcagcgtcaggaagaccacattgagctgatcgcctccgagaactac
acctccccggccgtgatggccgcgcagggttcgcaactgaccaacaagtacgccgagggc
tatcccggcaagcgttactacggcggttgcgaatacgtggacgtggtggaacagctcgcc
atcgaccgcgtgaagcagctcttcggcgccgaagccgccaacgtgcagccgaactcgggc
tcgcaggccaaccagggcgtgttcttcgccgtgctcaagccgggtgacacgatcatgggc
atgagcctggccgaaggcggccacctgacgcatggcatggcgctcaacatgagcggcaag
tggttcaacgtcgtcagctacggcctgaacgcgcaggaagacatcgattacgacgcgctc
gaagccctggcgcaagagaagaagccgaagctgatcatcgcaggcgcatccgcctttgcg
ctgcgcatcgatttcgagcgcatcggcaagatcgccaagtcgatcggcgcgtacttcatg
gtggacatggcgcactacgccggcctgatcgctgcaggtgtgtacccgaatcccgtgccg
cacgctgatttcgtcacgacgaccacccacaagagcctgcgcggcccgcgcggcggcgtg
atcctgatgaaggccgagcacgagaaggccatcaactcggcgatcttcccgggtatccag
ggcggcccgctgatgcacgtgatcgccggcaaggcggtggcgttcaaggaagcgctgtcg
ccggagttcaaggcttaccagcaacaggtcgtgaagaacgcggccgtcatggctgaaacg
ctcatggcccgaggcctgcggatcgtgtccggccgcacggagagccacgtgatgctggtt
gacctgcgcgccaagaagatcactggcaaggaagccgaaaaggtgctgggcgacgcacac
atcaccgtcaacaagaacgcgattccgaatgacccggaaaagccgttcgtgacgtcgggc
gtgcgcctgggttcgccggccatgaccacgcgtggcttcaaggaagccgaggccgtgaag
gtcgcccacctgatcgccgatgtgctggacaatccgcacgacgaagccaacatcgccgcc
gtgcgcgccaaggtggctgagctgaccaagcagttcccggtctacggctga

DBGET integrated database retrieval system