KEGG   Ralstonia pickettii 12D: Rpic12D_0723
Entry
Rpic12D_0723      CDS       T00925                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K16066  3-hydroxy acid dehydrogenase / malonic semialdehyde reductase [EC:1.1.1.381 1.1.1.-]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00240  Pyrimidine metabolism
rpf00260  Glycine, serine and threonine metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rpic12D_0723
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic12D_0723
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.381  3-hydroxy acid dehydrogenase
     Rpic12D_0723
    1.1.1.-  
     Rpic12D_0723
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 F420_oxidored Maf_N
Other DBs
NCBI-ProteinID: ACS62024
UniProt: C6BE64
Position
1:756432..757184
AA seq 250 aa
MIVFVTGATAGFGAAIARRFVREGHRVIAAGRRQDRLDALKAELGDAVLPFVLDVLDADA
VAALPGSLPEGWREVDVLVNNAGLALGLEPAQRADLTDWDRMIGTNCSGLVHMTRALLPA
MVERNRGHIINIGSIAGTYPYPGGNVYGATKAFVRQFSLNLRADLTGTRVRVSNVEPGLC
SGTEFSNVRFKGDDARVEKVYEGTEALTADDIAEAVYWMAALPAHFNVNAMELMPVCQSF
SATSVTRGMA
NT seq 753 nt   +upstreamnt  +downstreamnt
atgatcgtattcgtgaccggcgcaacggccgggttcggcgcggccatcgcgcggcgtttc
gtgcgagaaggccatcgtgtgatcgcggcaggccgccgccaggaccgtctcgacgcgctc
aaggccgaattaggcgacgccgtgctgccgttcgtgctggacgtgctggatgccgatgcc
gttgcggccttgccgggctccctgcccgagggttggcgcgaagtcgatgtgctggtcaac
aacgccggcctggcactgggcctcgaacccgcccagcgtgccgacctgaccgattgggac
cgcatgatcggcacgaactgctccgggctcgtgcatatgacgcgtgcgctacttcccgct
atggtggagcgcaatcgtggtcacatcatcaacattggctcgatcgcggggacgtatccg
tatccgggcggcaacgtgtatggcgccaccaaggcgttcgtccgccagttttcgttgaac
ttgcgggcagacctgaccggcacgcgcgtacgcgtatcgaacgtcgagccagggctgtgc
tccggcacggagttttccaacgtgcgtttcaagggcgacgatgcccgtgtggagaaggtt
tacgaaggcacggaagccctcaccgccgacgacatcgccgaagcggtctactggatggcg
gcgctgccggcgcacttcaatgtcaacgcgatggagctgatgcccgtttgccagtcattc
tcggccaccagcgtgacgcgaggcatggcctga

DBGET integrated database retrieval system