KEGG   Ralstonia pickettii 12D: Rpic12D_0724
Entry
Rpic12D_0724      CDS       T00925                                 

Definition
(GenBank) tol-pal system-associated acyl-CoA thioesterase
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rpic12D_0724
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rpic12D_0724
SSDB
Motif
Pfam: 4HBT 4HBT_2
Other DBs
NCBI-ProteinID: ACS62025
UniProt: C6BE65
Position
1:757254..757658
AA seq 134 aa
MSSFDWNLRVYWEDTDAGGVVFYANYLKFFERARTEWLRALGVDQQVLADTTGAIFVVRS
TAVDYRAPARLDDLLQIRSRMERVGPASVQFAQEGWRGDVLLASGTIRVGCVDRLTFRPT
PIPAPVLATIKAAA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtcttcttttgactggaacctgcgcgtgtattgggaagataccgacgcaggcggcgtc
gtgttttacgccaactatttgaaatttttcgagcgcgcccgcaccgagtggctgcgcgcg
cttggggtcgatcagcaggtgctggccgacacgaccggagccattttcgtggtgcgtagc
actgccgtggattaccgcgcgccggcacgcctggacgacctgcttcagatccgttcgcgt
atggaacgggtcggccccgcgtcggtccaattcgcccaagaaggctggcgcggcgacgtt
ttgctcgcatcaggcacgattcgtgttggatgtgtcgaccggctcactttccggccgacc
ccgattcccgctcccgtactcgcaaccatcaaagccgccgcatga

DBGET integrated database retrieval system