KEGG   Ralstonia pickettii 12D: Rpic12D_0726
Entry
Rpic12D_0726      CDS       T00925                                 

Definition
(GenBank) protein TolR
  KO
K03560  biopolymer transport protein TolR
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpf02000]
    Rpic12D_0726
Transporters [BR:rpf02000]
 Other transporters
  Pores ion channels [TC:1]
   Rpic12D_0726
SSDB
Motif
Pfam: ExbD DUF2149
Other DBs
NCBI-ProteinID: ACS62027
UniProt: C6BE67
Position
1:758360..758794
AA seq 144 aa
MATIQRTRRARRAKADINVVPYIDVMLVLLVIFMVAAPVVNPGVVNLPSVANATPQQTQP
PIVVTIKSDGTILARIKTGSGATEQKLANNNELRAFVKQRTDENPDQPVVIAADKSVQYD
RVLTVMSVLKGDGVKRVGLMVKSS
NT seq 435 nt   +upstreamnt  +downstreamnt
atggctaccatccagcgaacgcgccgcgcccgacgggccaaggccgacatcaacgtcgtt
ccgtacatcgacgtgatgctggtgctgctggtcatcttcatggtggcggcgcccgtggtg
aacccgggcgtggtcaatctgccatcggtggccaacgcgacgccgcagcagacgcagccg
cccattgtggtgaccatcaagagcgacggcacgatccttgctcgcatcaagaccggttcc
ggcgccaccgagcagaagctcgccaacaacaacgagctgcgcgcattcgtgaagcagcgc
actgacgaaaaccccgaccagcccgtcgtgattgccgccgacaagtcggtccagtacgac
cgcgtgctgaccgtcatgagcgtgctcaagggcgatggcgtaaagcgcgtcggcctgatg
gtgaaatcgtcatga

DBGET integrated database retrieval system