KEGG   Ralstonia pickettii 12D: Rpic12D_0729
Entry
Rpic12D_0729      CDS       T00925                                 

Definition
(GenBank) peptidoglycan-associated lipoprotein
  KO
K03640  peptidoglycan-associated lipoprotein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpf02000]
    Rpic12D_0729
Transporters [BR:rpf02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Rpic12D_0729
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: ACS62030
UniProt: C6BE70
Position
1:761276..761797
AA seq 173 aa
MSKSQTMIKLAAIAALLALGACSSGVKLDDTAKNGTGGAAGTGADARTVTPVDVGRDELT
DPNSPLAKRSIYFDFDSYSVKPEYQGLLGQHSRYLQSHNQRKVLIQGNTDERGTSEYNLA
LGQKRAEAVRRALSSMGVPDSQMEAVSLGKEKPQATGHDEDSWAQNRRADIVY
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtcgaagtcccaaaccatgatcaaactcgcagccattgccgcgctgctggccctgggc
gcttgcagctcgggcgtgaagctggacgatacggccaagaacggtacgggcggtgccgcc
ggcacgggtgcggatgcccgcacggtgaccccggtggacgtgggccgcgacgagctgacc
gacccgaacagcccgctggccaagcgcagcatctacttcgatttcgacagctactcggtc
aagccggagtaccaaggcctgctgggtcagcactcgcgctacctgcaatcgcacaatcag
cgcaaggtcctgatccagggcaacaccgacgagcgcggcacgagcgaatacaacctcgca
ctgggccagaagcgtgccgaggccgtgcgtcgcgccctgtcgtcgatgggcgtgcctgac
agccagatggaagccgtgagcctgggtaaggaaaagccgcaagcgaccggccacgacgaa
gactcgtgggcacagaaccgccgcgccgacatcgtctattaa

DBGET integrated database retrieval system