KEGG   Ralstonia pickettii 12D: Rpic12D_0731
Entry
Rpic12D_0731      CDS       T00925                                 

Definition
(GenBank) exsB protein
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00790  Folate biosynthesis
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpic12D_0731
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpf03016]
    Rpic12D_0731
Enzymes [BR:rpf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     Rpic12D_0731
Transfer RNA biogenesis [BR:rpf03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Rpic12D_0731
SSDB
Motif
Pfam: QueC Asn_synthase ThiI NAD_synthase tRNA_Me_trans Arginosuc_synth ATP_bind_3
Other DBs
NCBI-ProteinID: ACS62032
UniProt: C6BE72
Position
1:762815..763489
AA seq 224 aa
MKKRAIVLLSGGLDSATVLAMANADGFETYALSMRYGQRHSSELEAAKKVAAALGAVRHE
IVDLDLRKFGGSALTDDALDVPTDGAQTGIPITYVPARNTIMLSLALGWAEAVGARDLFF
GANAVDYSGYPDCRPEYVAAYETLANLATKAGVEGERIRVNAPIIDMTKAEIIQAGVRLG
VDYGLTVSCYKADDAGRACGVCDSCRIRKAGFEAAGVPDPTRYV
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaaaaaacgcgccatcgtcctgctctccggcgggctggactctgccaccgtgctcgcc
atggccaatgcggacggttttgagacttacgcgctgtcgatgcgctacggccagcgccat
tcgtccgagttggaagcagccaagaaagtggcggcggcgctcggcgcagtgcgacatgaa
atcgtcgatctggacttgcgcaagttcgggggctccgcgttgacggacgatgcgctcgac
gtgccgactgacggcgcgcagacgggtatcccgatcacgtatgtgccggcgcgcaacacg
atcatgctgtcgctggcgcttggctgggccgaggcggtcggcgcacgcgacctgttcttt
ggcgcgaatgccgtggactactccggctatccggattgccgccccgaatacgttgccgct
tacgaaacgctcgccaacctggcgacaaaggccggtgtggaaggcgagcgcatccgagtg
aacgcacccatcatcgacatgaccaaggcggaaatcatccaggccggtgtgcggctgggc
gtggactacggcctgaccgtgtcgtgctacaaggccgacgacgccggccgcgcttgcggc
gtgtgcgattcgtgccgcatccgcaaggccggctttgaagccgcgggcgtgcccgatccc
acccgctatgtctga

DBGET integrated database retrieval system