KEGG   Ralstonia pickettii 12D: Rpic12D_0732
Entry
Rpic12D_0732      CDS       T00925                                 

Definition
(GenBank) protein of unknown function DUF395 YeeE/YedE
  KO
K07112  uncharacterized protein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rpic12D_0732
SSDB
Motif
Pfam: Sulf_transp
Other DBs
NCBI-ProteinID: ACS62033
UniProt: C6BE73
Position
1:763496..764611
AA seq 371 aa
MPDIDLNVLSHTVLWGTFVLTFVFGAILQRTHFCTMGAVSDVVNIGDWNRLRMWALAIGV
AMIGTGCLSWLGLIDTSKTIYTASKLLWLSSLVGGLLFGFGMVLGSGCGSKTLVRIGGGN
LKSVVVFVFLGLAAYMTLKGVFGVVRVATVDSVAVALPTSQDLPSVLGHAFSGDVRMLRL
VLALGIGGALSLWALLGRDFRTGDNLLGGIGVGLIIVGMWYVSGHLGYVQEDPNTLQEAF
VATNSGRMEALSFVAPVSYTLEWLMFFSDTSKVLTVGIVSVLGVIAGSAAVALATRTFRW
EGFANAEDTGNHIIGGILMGIGGVTALGCTIGQGLSGVSTLAIGSFIALAGIVIGAVLAF
RYQMWRMEQLV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcccgatatcgacctcaacgtgttgtcccacacagtgctgtggggcacgtttgtgctg
acgttcgtgtttggcgcgatccttcagcgcacgcacttctgcacgatgggcgcggtgtcc
gatgtcgtcaacatcggcgactggaatcggctgcgcatgtgggcgctggccatcggcgtg
gccatgatcggcacgggatgcctgagctggcttggcctgatcgatacgagcaagacgatc
tacacggcgagcaagctgctgtggctgtcgtcgctggtgggcgggctgttgttcggcttc
ggcatggtgctgggctcggggtgcggcagcaagacgctggtgcgcatcggcggcggcaat
ctcaagtcggtcgtggtgttcgtgttcctggggcttgcggcgtacatgacgctcaagggc
gtgtttggcgtggtgcgtgtggcaacggtggacagcgtagccgttgcgttgccgacgtcg
caggatctgccgagcgtgctgggccacgcgttctccggcgatgtgcgcatgctgcgtctg
gtgctggcgctggggatcggcggggcgctgtcgctgtgggcgctgctggggcgcgatttc
cgcacgggcgacaacctgctgggcggcatcggcgtcgggcttatcatcgtcggcatgtgg
tacgtatcggggcatctcggttacgtgcaggaagatccgaacacgctgcaggaagcgttt
gtggcgaccaacagcgggcgcatggaagcgctgagcttcgtggctccggtgtcgtacacg
ctggagtggctgatgttcttcagtgatacatcgaaggtactgacggtcggcattgtgagc
gtgcttggcgtgattgcaggatcggcagcggtggcgctggccacgcgcacgttccgctgg
gagggctttgccaatgccgaggacacgggcaaccacatcattggcggcatcctgatgggc
attgggggcgttacggcgctgggttgcacgatcgggcaggggctgtcgggcgtgtcgacg
ctggcgatcggttcgttcatcgcgctggccggcatcgtgatcggtgcggtgctggcgttc
cgctaccagatgtggcgaatggagcagctcgtttga

DBGET integrated database retrieval system