KEGG   Ralstonia pickettii 12D: Rpic12D_0733
Entry
Rpic12D_0733      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62034
UniProt: C6BE74
Position
1:766719..767234
AA seq 171 aa
MSDFLNTIGTLHTLEKMGEQGRTIDRQGRALDSMGDALRRSQEDAGMAEAGAAFQRNRAN
ELEALLSKPMAEIAAKNGRFRETYEKQQELIADWIVSQRAFKELAMKYGQLAGKTPEEIQ
KEGMAAEATIVTDQSQFGNNVNEAQKSAYKRKKAREEKQAQAAQNKATHSA
NT seq 516 nt   +upstreamnt  +downstreamnt
atgagcgactttttgaatactatcggtactttacataccttggaaaagatgggcgaacaa
ggccgcaccattgatcgtcaaggccgtgctcttgatagcatgggggacgcattgcgccgc
tcccaagaagatgcggggatggcggaggctggtgcagcattccaacgcaatcgtgctaac
gaattggaagcacttctgtccaagcctatggctgagattgctgctaagaatggtcgtttc
cgcgaaacctatgaaaagcaacaagagttgatagctgactggattgtgtctcagcgtgct
ttcaaagaactggctatgaagtatggtcagttggcgggtaagacccctgaagaaattcaa
aaagaaggtatggcagcagaagcaactattgttacggatcagtctcagttcggcaacaat
gttaatgaggcacaaaaatctgcttacaaacgcaagaaggctcgtgaagaaaagcaggct
caagcagcacaaaacaaagccactcattccgcctaa

DBGET integrated database retrieval system