KEGG   Ralstonia pickettii 12D: Rpic12D_0734
Entry
Rpic12D_0734      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62035
UniProt: C6BE75
Position
1:767371..767586
AA seq 71 aa
MSLSYTLPSGIFSSIAFVIKDVFVTQTITLVGQKPKTPIECQQLTHPLIGNGIGIENSSE
STNVLSTYQLT
NT seq 216 nt   +upstreamnt  +downstreamnt
atgtcactatcatatacactaccaagcggaatattttcctcaatcgccttcgtcattaag
gatgtcttcgtgacccaaaccatcacccttgtaggtcagaagccaaaaacacctattgag
tgtcagcagctcacgcacccgcttatagggaacggcattggaatagagaactcctcggaa
tcgactaatgttctcagcacctaccaactcacctaa

DBGET integrated database retrieval system