KEGG   Ralstonia pickettii 12D: Rpic12D_0735
Entry
Rpic12D_0735      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62036
UniProt: C6BE76
Position
1:complement(767657..768097)
AA seq 146 aa
MGSVKYLFCILILLSHNPYVASFFKGSPTEPYIHCATQMLLLFALYETGFIAGKQLYHGV
YTDYKRFSISRFFRIFPPCWLMLGLSFLLMPNSMLYLREGGNVFSDIASLDLGDKIFYYA
SHVFLLINLLFYVSYDKATHSLDSLS
NT seq 441 nt   +upstreamnt  +downstreamnt
atgggaagtgtgaagtatcttttctgtatcttgattttactcagccacaacccctatgtg
gctagtttcttcaaaggctcccccactgagccatacattcactgcgcaacccaaatgttg
ctgctttttgctttatacgagacaggctttatagcaggcaagcagttgtatcacggtgtc
tatacagactacaaaaggttcagcatctccaggttcttccgaatcttccctccctgctgg
ttgatgctcgggctgagctttcttctcatgcccaattccatgctgtaccttcgtgaaggt
gggaacgtgttctccgacatagcctctctggacttaggcgacaaaattttctattacgcc
tcacacgtcttcctgctcatcaacctcctattctatgtgtcctacgacaaggcaactcat
agcttagattccctatcatga

DBGET integrated database retrieval system