KEGG   Ralstonia pickettii 12D: Rpic12D_0736
Entry
Rpic12D_0736      CDS       T00925                                 

Definition
(GenBank) transposase IS204/IS1001/IS1096/IS1165 family protein
  KO
K07485  transposase
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Rpic12D_0736
SSDB
Motif
Pfam: DDE_Tnp_ISL3 HTH_Tnp_ISL3 zf-ISL3 VWA_N2
Other DBs
NCBI-ProteinID: ACS62037
UniProt: C6BE77
Position
1:768235..769530
AA seq 431 aa
MGIAVEALFTSALGLQPPWVVDDVRLDTAKRRIDFEIGCHTSRLACPACGAATQPVHDRL
RRSWRHLDFFQFEAWLHCDVPRVACGACGKTTQVAVPWARPGSGFTAAFEALALTLCLDL
PVRQAAELLRCKDKRLWRRIEFYVEQARALEDFSGVRTVGIDETSLRRGQHYITVVHDLD
RKRLLFATEGREHRTVVEFAEDLKAHGGDPAQVRHVCMDMSAAYAKGVALALPEAQISYD
RFHVVSMAIEAMDQVRRAEMATDAQAVRAALGTGQRKTLRQLLWGMRRNPSSWSARQIQA
MHWLQRSTLKSARAWRLKMALREVYARATAHNSIEQAASDLRAWLSWARRCRLEPFKKLA
ATLKERFDAVVRGMVDHRSNAFVEAMNGLLQQAKRAARGFRTSQNFIAIAYLRMSKLKHL
PASPFAPAMPQ
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgggcattgccgtagaagctctgttcaccagcgcgctgggcttgcagccgccgtgggtc
gtcgatgacgtcaggctcgacaccgccaagcggcgtatcgacttcgagatcggctgccac
accagcaggctcgcctgcccggcatgcggtgcggccacgcaaccggtgcacgaccggctg
cgccgatcctggcggcacctggacttcttccagttcgaggcctggctgcactgcgacgtg
ccgcgcgtggcctgcggtgcctgcggcaagaccacgcaggtggccgtgccctgggcgcgt
ccgggctcgggcttcaccgcggcgttcgaagcgctggcgctgaccttgtgcctggacctg
ccggtgcgccaggccgccgagttgctgcgctgcaaggacaagcggctgtggcggcgcatc
gagttctacgtcgagcaggcgcgtgcgctggaagacttctccggcgtgcgcacggtgggc
atcgacgagaccagcctgcggcgcgggcagcactacatcaccgtcgtgcacgacctggat
cgcaagcggctgctgttcgccaccgaggggcgcgagcaccgcacggtggtggagttcgcc
gaggatctgaaggcccatggcggcgatcccgcccaggtgcggcacgtgtgcatggacatg
agcgcggcctacgccaagggcgtggcgctggcgctgcccgaggcgcagatcagctacgac
cgctttcacgtcgtctcgatggccatcgaggcgatggaccaggtgcgccgcgcggagatg
gccaccgacgcgcaggcggtgcgagccgcgctgggcactggccagcgtaagacgctcagg
cagctgctgtggggcatgcggcgcaaccccagcagctggagcgcccgccagatccaggcg
atgcactggctgcagcgctcgacgctcaaaagcgcgcgggcgtggcggctgaagatggcg
ctgcgcgaggtgtacgcgcgggccacagcgcacaacagcatcgaacaggccgcatccgac
ctcagggcctggctgagctgggcgcggcgctgtcggctcgagccgttcaagaagctggcc
gccacgctcaaggagcggttcgacgcggtggtgcgcggcatggtcgatcaccgcagcaac
gccttcgtcgaggcgatgaacgggctgctgcagcaggccaagcgcgccgcgcgcggcttc
aggacgagccagaacttcatcgccatcgcctacctgcgcatgtccaagctcaagcacctg
ccggccagcccgttcgcgccggcgatgccccagtga

DBGET integrated database retrieval system