KEGG   Ralstonia pickettii 12D: Rpic12D_0737
Entry
Rpic12D_0737      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62038
UniProt: C6BE78
Position
1:770223..770738
AA seq 171 aa
MSDFLKTIGTLHVLEKTGEQSRAIERQGIELERQQQAVRDAQRDAGMAEGNANFHRRRAE
EYEELLAKPMAEIAAKNGRFRETYDKQQEMLADWILSQRAFKELAMKYGKLAGKTPEEIQ
AEGMATKEIILDGQSQFGNTVTETEKANLQRKKAREEKQAQAAQNKATHSA
NT seq 516 nt   +upstreamnt  +downstreamnt
atgagcgactttttgaaaactatcggtaccttgcatgtcttggaaaagacaggtgaacaa
tcacgtgccattgagcgtcagggcattgaattggaacgccagcaacaagcggttcgtgat
gctcagcgtgatgctggtatggcagagggcaacgccaactttcatcgtcgccgtgcagaa
gaatacgaagaattgcttgccaagcccatggctgagattgctgcaaagaatggtcgtttc
cgcgaaacctatgacaagcagcaagagatgttggctgactggatcttgtcccagcgtgcc
ttcaaagaattggctatgaagtatggtaagttggctggcaagactcctgaagagattcag
gctgaaggtatggcaaccaaggaaatcattcttgatggtcaatcgcagttcggaaacacc
gtgaccgaaaccgaaaaagctaacttgcaacgcaagaaggctcgtgaagaaaagcaggct
caagcagcacaaaacaaagccactcattccgcctaa

DBGET integrated database retrieval system