KEGG   Ralstonia pickettii 12D: Rpic12D_0739
Entry
Rpic12D_0739      CDS       T00925                                 

Definition
(GenBank) transposase IS3/IS911 family protein
  KO
K07483  transposase
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Rpic12D_0739
SSDB
Motif
Pfam: HTH_Tnp_1 TSC22 DUF1323
Other DBs
NCBI-ProteinID: ACS62040
UniProt: C6BE80
Position
1:771705..772034
AA seq 109 aa
MSKNNANKFSPEVRERAVRLVQESRGEYPSLWVAVESIAPKIGCSAQTLLTWVKRHEVDS
GQREGVTTSERERIKELERENRELRRANDILRTASAFFAQAELDRKLKS
NT seq 330 nt   +upstreamnt  +downstreamnt
atgagcaagaacaacgcaaacaagttttccccggaagtgcgcgagcgcgccgtgcgcctg
gtgcaggagtcgcgcggcgagtacccgtcgctgtgggtggcggtcgagtccatcgcgccc
aagatcggctgctcggcgcagacgctgctgacctgggtcaagcgccacgaagtcgacagc
ggacagcgcgaaggcgtcaccaccagcgagcgagaacgcatcaaggagttggagcgggag
aaccgagagctgcgccgcgccaacgacatcctgcgcactgccagcgcttttttcgcgcag
gcggagctcgaccgcaagctgaagtcgtaa

DBGET integrated database retrieval system