KEGG   Ralstonia pickettii 12D: Rpic12D_0740
Entry
Rpic12D_0740      CDS       T00925                                 

Definition
(GenBank) Integrase catalytic region
  KO
K07497  putative transposase
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Rpic12D_0740
SSDB
Motif
Pfam: rve HTH_21 rve_3 rve_2 HTH_Tnp_Tc3_2
Other DBs
NCBI-ProteinID: ACS62041
UniProt: C6BE81
Position
1:772088..772945
AA seq 285 aa
MLQVASSAYRRHAARLRDPSRRSDRARRDERLMPQVQRVWQENHRVYGADKVWRQLNREG
VTVARCTVERLMRAQGLQGVRRGKRLRTTIADDAASRPVDRVNRQFRADRPNQLWVSDFT
YVSTWQGWLYVAFVVDVYARRIVGWRVSKSMTTDFVLDALEQALYARQPGNDGSLTHHSD
RGSQYVSIRYSERLAEAGIEPSVGSRGDSYDNALAETINGLYKAELIHRRAPWKTRESVE
LATLEWVAWFNHKRLHSSIGYIPPAEAEANYYNQLGKTADEAVLL
NT seq 858 nt   +upstreamnt  +downstreamnt
gtgttgcaggttgcctcgtcggcctatcggcgccatgccgcacggctgcgtgatccgtca
cggcgcagcgaccgtgcgcgtcgtgatgaacggctcatgccgcaagtccagcgagtgtgg
caggagaaccatcgcgtctacggcgccgacaaggtctggcggcaactgaaccgcgagggc
gtgacggttgcccgctgcacggtcgagcgattgatgcgcgcccagggactgcaaggtgtg
cggcgcggcaagcggctgcgaacgaccatcgctgacgacgccgccagtcgcccggtggat
cgcgtcaaccggcagttccgggccgaccgtcccaatcagctctgggtctcggacttcacc
tacgtctcgacatggcagggttggctgtacgtggccttcgtcgtcgacgtctacgccagg
cgcatcgtcggctggcgcgtgagcaaatccatgacgacggacttcgtgctcgatgcgctg
gagcaggccctatacgctcgccagcctggcaacgacggttctctgacccaccactccgat
aggggatcgcagtacgtcagcatccgctatagcgaacgcctggccgaagccggcatcgag
ccgtcggtcggcagccgtggcgacagttacgacaacgccttggccgagacgatcaatggc
ttgtacaaggccgagctgatccatcgccgcgcgccttggaaaaccagggaatccgtcgaa
ctggcaacactggaatgggtcgcttggttcaaccataagcgcctgcactcatccatcggc
tatatcccgcccgccgaggctgaggcaaactactacaaccaactcggcaaaaccgccgac
gaggccgttttactttaa

DBGET integrated database retrieval system