KEGG   Ralstonia pickettii 12D: Rpic12D_0742
Entry
Rpic12D_0742      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
  KO
K07313  serine/threonine protein phosphatase 1 [EC:3.1.3.16]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rpic12D_0742
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Rpic12D_0742
SSDB
Other DBs
NCBI-ProteinID: ACS62043
UniProt: C6BE83
Position
1:773591..774256
AA seq 221 aa
MESNHDTASTNPYVQFLFAGEPVAFLVDTNLTLGEGIFIALVYPSIHVGVEKPWFHAVQG
NHEEMAIVWGHMGESVDDYKRHGGERLMSMSHEDQLAYVTALAELPYAIQVETSGGLVGL
VHADLSESTWRGMWEKMHNDASREEIEEVKEHILWSRQRYMKRHAHAPIIPDVRAVVVGH
TTVSEALLLGNVHYLDTGGWTPRGHFTFLELATLQINPAKF
NT seq 666 nt   +upstreamnt  +downstreamnt
atggaatccaatcacgatacggcgtctaccaacccttacgttcagttcctttttgctggt
gagccagtagcctttcttgtcgatacgaaccttaccttgggggaggggatcttcattgcc
ttagtttatccaagcatccatgttggagtagaaaagccttggttccatgctgtccaaggc
aaccatgaggaaatggcaattgtctggggccatatgggggaaagtgtagacgattacaag
aggcatggcggagaacggcttatgagcatgagccacgaagaccagcttgcctatgtaaca
gccttagctgaactaccctatgccatacaggttgaaacatcaggcggcctcgttggcttg
gttcatgcagacctatcagagtcaacgtggcgcggcatgtgggagaaaatgcacaatgat
gcctctcgtgaagaaatagaagaggtcaaagaacacattctatggagccgccagcgatac
atgaaacggcacgctcatgctccaatcattccggacgtacgggcagtggttgtgggacac
accactgtttcagaggcgctattgctaggaaacgtccactacttggatacaggcggctgg
acccctcgggggcacttcacgttcttagaacttgccaccctacaaattaaccctgccaaa
ttctga

DBGET integrated database retrieval system