KEGG   Ralstonia pickettii 12D: Rpic12D_0743
Entry
Rpic12D_0743      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62044
UniProt: C6BE84
Position
1:complement(774384..775526)
AA seq 380 aa
MNIFYPPVALAVVAILYFRRSKYPFMLTFGQKVTKVVLQTGLILIGVFLVAVLSEVGRRL
TGNDPGLMSDHAFLDLMIITIAAYFVTCYRGHPKGSPIAKLRSFLATLTAILVSLLVFGI
VASNMNMAAASLIPSLLMVFGATDKLILREMSVQQGAAVSPTHYISKNFEIKLIDNSSAE
KLEDRFSVYLRYDSGKNHGRLIADLKKRYGDEIEPNKVVADFDGHIVAYGVEFSGDKLLY
AEYGCAFSWGCQEKVVTRTGRDVKRTVVGGGTSLGMTTGGEMVFVSNPTTTVTEYGDTYT
YDNRYGIFEFFMFFDEVASISPVSNSDPFSGYERNDEGRDDLSKQLFVKYFDENGIETLG
GVLSQIRKVLIESGNGVRRR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaatattttctaccctccagttgctttggcggtcgttgcgattctctatttcaggaga
agcaaatatccgttcatgttaacttttggacaaaaggtaaccaaggtagttctccaaact
gggctcatattgatcggtgtttttcttgttgctgttctaagcgaggtggggcggcgtcta
acgggaaatgatccgggactgatgtctgatcatgcctttctcgatctgatgattattact
attgccgcttatttcgtcacctgctatagggggcatccaaaagggagtccaatagctaag
cttcggagcttcttggctaccttgactgcaattttggtcagtcttttagtttttggcatc
gttgcaagcaatatgaacatggcagcggcatctctaattccatcattacttatggtgttt
ggtgctactgataaacttatccttagagagatgagtgttcagcaaggggccgctgtttcg
cctacccactatatctcaaagaattttgaaattaaacttatcgacaactcttctgccgag
aagttggaggatagattttctgtgtatttgcgatatgattctggaaagaatcatggaaga
ctaattgcggacctcaagaaacgctatggcgatgaaattgagccgaacaaggtggtggca
gattttgatggccatatcgtagcctacggggttgaattttcaggtgacaagctgttgtat
gccgaatacggctgtgcatttagttggggctgtcaagaaaaggtggttacccgaacgggt
agagatgtgaaacgcaccgtagtagggggtggcactagtttgggcatgacgactggtgga
gaaatggtctttgttagcaatccaacaacgactgtgactgagtatggcgacacgtacacc
tacgacaatagatatggtatttttgagtttttcatgttttttgatgaggttgcttcaatt
tctcctgtctcgaattcagacccgttttcgggatatgagcgaaatgatgaagggcgcgac
gatttgagtaagcaattgtttgttaaatattttgatgagaatggtattgaaactctagga
ggcgtcctttctcaaataagaaaggtattgatcgagtctggaaatggggttaggaggcgg
tga

DBGET integrated database retrieval system