KEGG   Ralstonia pickettii 12D: Rpic12D_0745
Entry
Rpic12D_0745      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: YfbU DUF3080 UMPH-1
Other DBs
NCBI-ProteinID: ACS62046
UniProt: C6BE86
Position
1:complement(776119..777072)
AA seq 317 aa
MGFFKTAATLHALEKVADNERAQAKQNQIINEQNDRITGLEEELRRARRANDNYLPAPSG
REMDLERKVQELGDIENLLARPMKEIAEKNFFFKHTYMKQQELLSNWMVSQKAFHEIALR
YGKALGKSVEEVLVEVTQAETTVIEGRAEFGSPMNPMAKEALGYGARHAVKVESEEKEKK
KRFLKIQRGWLADWEDLEKKRPLSKEETDKRDDLIKEIGDMEAELAMPPATPELHVKSAF
SYIEEAQAEAKRGEAEEFERRRKAQREADESHLEDFERVLERWRLVEKQRELTSEDKEKI
GRIQNLLKECKERLGLA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgggattttttaaaaccgctgctacgttgcatgcgctggaaaaggtcgccgataatgaa
agagcgcaagcaaagcagaatcaaatcatcaatgaacagaacgacagaattaccggcctg
gaagaagaactaaggcgtgccagaagagccaacgacaactatctccccgctccttcgggt
cgagaaatggacctggaaagaaaggttcaagaattaggggatattgaaaatcttctggct
cgtccgatgaaggagattgcggagaagaattttttcttcaaacatacttacatgaaacag
caggagttactgtctaactggatggtctcacagaaagcttttcatgaaattgcgcttcgg
tacggaaaagcgctggggaagagtgttgaagaagtattggttgaggtcacgcaggcagaa
acgaccgtcattgaaggacgggcggaatttggttctccaatgaatccaatggcaaaggag
gcattgggatatggcgcacgccatgctgtcaaggttgagagcgaagagaaagaaaagaag
aaaaggttcttaaagattcaacgcggttggttggcggattgggaggatctcgagaagaag
cgtcctctctcgaaagaagagacggataagcgggatgatctcatcaaggaaatcggcgac
atggaagccgagcttgccatgccgcctgctactcctgaactccacgtgaaatccgctttt
tcttatattgaggaggcgcaggcagaggcgaaaaggggcgaggcggaagaattcgagaga
agaagaaaggcacaaagagaggccgatgagagtcatttggaggattttgaaagagtattg
gagagatggaggcttgtggaaaaacaaagggaattgacgagtgaggataaagaaaaaatt
ggacgtatacaaaatttgttgaaagaatgtaaagaaagacttggattggcgtga

DBGET integrated database retrieval system