KEGG   Ralstonia pickettii 12D: Rpic12D_0746
Entry
Rpic12D_0746      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62047
UniProt: C6BE87
Position
1:complement(777122..777343)
AA seq 73 aa
MSDKTGVRFVMGLPEQQEAENRTHAITIPRKNPQNNEPHDKIWERLLNTEESKEFLDGEV
RKAANFVGKNQVE
NT seq 222 nt   +upstreamnt  +downstreamnt
atgtcagataaaactggagtgagattcgtcatgggcctgcctgagcaacaagaagccgaa
aaccgaacccatgccataacaatccctcggaaaaatccgcaaaataatgagccacatgac
aaaatatgggaacgcttgctcaacaccgaggagagcaaagagtttcttgacggagaggta
aggaaagctgcaaatttcgtaggtaaaaatcaggtcgagtga

DBGET integrated database retrieval system