KEGG   Ralstonia pickettii 12D: Rpic12D_0747
Entry
Rpic12D_0747      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF4131
Other DBs
NCBI-ProteinID: ACS62048
UniProt: C6BE88
Position
1:complement(777398..778051)
AA seq 217 aa
MKTTIDAPIQPKRKCRVEKVSDHEGVIHFRTGCWHTIFDWLLIGIILVATFVACVIAGGA
LSSVIGSIFLHQNWLLSEWWRDVILIFGLYIMFAIWFIKQTWPGKAAITVIPEGVKWEAH
QVTFDDMLELSVTSVTEKSADRYSRLVLSLTNKARASLSHGWTKGSILRDVRDTILEIGL
MFQPQGAGRHVVMRSIGSSTLPPSRKLEDYIAGLENR
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaagacaacaattgatgctccgattcagccgaaaagaaagtgtcgggtggagaaagtg
tcggatcatgagggggtcattcattttcgcacgggctgttggcatacgatattcgactgg
ctgcttatcggtatcattcttgtcgctacgttcgtcgcgtgcgtaatcgctggaggtgct
ttgtcatctgtaatcggaagtatatttttgcaccagaattggttgctgagcgaatggtgg
cgagacgtgattttgatatttggtctttatatcatgtttgcaatctggttcataaagcaa
acatggccaggaaaggcggcgatcacagtgattcctgagggtgtcaaatgggaggcgcac
caagtgacatttgatgatatgttagagctatccgtgacgtccgtgacagaaaaatcagca
gaccgttatagtcgcctcgttttgtcgttaactaataaagctcgtgcatccctctcccac
ggttggacaaaggggtcgattttgcgagacgtccgagacaccattcttgagattggcctg
atgtttcagccccagggcgcgggtcgccatgtcgtcatgcgatctatcggttcgagcact
ctaccgccctcaagaaaacttgaggattacatagcaggattggagaatcgttga

DBGET integrated database retrieval system