KEGG   Ralstonia pickettii 12D: Rpic12D_0748
Entry
Rpic12D_0748      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF4131
Other DBs
NCBI-ProteinID: ACS62049
UniProt: C6BE89
Position
1:complement(778078..778893)
AA seq 271 aa
MKTEAYVEHGKWVTDHIAPINAVMTISTAVFIPLLDVLRPYFPYIGYVAGLAVLVFLALL
VMKVLGIPRGKQLQTSIVICSGVCAAAFSVGAIASARHADQGGAIAASAPWVAQLQQTLL
DIKDGKSDNPRVELKNMGVEWTPGNLLQASKDGDTKVVELFLKGGMPVTLNGTGNDRQLP
FYVVANNYPKAKEQLKLFKENGVDLNDPQLAAFNNTDLSTQPPNLYAVAKDHGHEELASY
LAELGVKTDGYPAWQKRKEEMQKKNKGIYLS
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaaaacagaggcttacgtagaacatggcaagtgggtgacggaccacattgctccgatc
aatgcggtcatgacgatctccactgccgttttcattccgctcctggacgtcctgcgccca
tactttccctacattggctatgtggctggcctggcggttcttgtgttcctcgccctgctg
gtcatgaaggtgctggggattccaagaggtaagcagttgcaaaccagcattgttatctgc
tctggggtatgcgcagcagcctttagcgtgggagccattgccagcgctcgccatgccgat
caaggcggggcaatagcagccagtgcgccttgggtggcccaacttcagcagaccctcttg
gacataaaggatggcaagagcgataaccctcgcgtggagctcaagaacatgggcgtggaa
tggacgcctggcaatctgctccaagcctccaaggatggcgacacgaaagtggtggagctg
ttcttgaagggagggatgcccgtgacccttaatggcaccgggaatgatcgacaactacca
ttctatgtcgttgcgaacaattatcccaaagccaaggagcagctaaagctcttcaaggaa
aatggcgtggatctgaacgatccgcagcttgctgctttcaataatacggatctatccacg
cagccgccgaatctttacgctgtagccaaggatcatgggcatgaagaactggcgtcctat
cttgccgagcttggtgtgaaaacggacggctaccccgcttggcagaagaggaaagaggag
atgcagaagaagaataaaggaatatatctttcttga

DBGET integrated database retrieval system