KEGG   Ralstonia pickettii 12D: Rpic12D_0749
Entry
Rpic12D_0749      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS62050
UniProt: C6BE90
Position
1:complement(779111..780325)
AA seq 404 aa
MKTASVYKAKTRSLSVSSILALSTIMVALTACGGGGDGSGSSSTPTSGGSTTTTPQQDAV
SQSSAALVAQTGATAVPGTTSTAQAFDLTADIGDTWRLVLNQDGSFTIKVLSTQYSLTDI
SGTYTQSTSGSFTTYTGTSTNGSFTLKLDTRTHIMGGDVVLRTRSSSVAGSGYSVPSDTT
KLAGDYFFIGTSRNASNGGVPAFMGGTFRIAANGTDVTLCDSGLINASGTCNAVSGSSTP
GQYALKLVKNAADGLTHVQQNGSDFGILSFQAGDRGPVLVIDRFGYNQDTPPVLRTGVFY
AGKQQVLSGTELNGTWTCSDRGAVFGTVTINGTTVKTADTSGASTAETLYFNDISTNTGL
VAANGAATSVVNGQAPSAGVIVLPLSSSMFAVERDAAQSVGVCR
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgaaaaccgcctcggtatacaaagcaaagacgcgttctctctccgtttcgagcatcctc
gctctcagcaccatcatggtcgccttgacggcgtgtggcggcggcggagatggcagcggc
agcagcagtacgccgacgtcggggggctcgaccacgaccacaccccagcaggacgcggtc
agccaatcgtcggcggctctcgtcgcccagactggcgcaaccgccgtgcccggaacgacc
tcgaccgcgcaggcattcgatctcacggctgacatcggcgacacatggcgtctggtgctg
aaccaggacggctcgttcacgatcaaggtgctgtctactcaatatagtctgaccgacatc
tcgggcacctatacccaatcgacgagcggcagtttcacgacgtacacgggcaccagcacg
aacggcagcttcacgctcaagctggacacgcgcacccacatcatgggtggtgacgtcgtc
ctccgtacgcgtagctccagcgttgcgggctcgggctattccgttccttcggacacgacc
aaactggccggcgactatttcttcattggcacatcccgcaatgccagcaacggcggagtt
ccagcgttcatgggcggcacgttccgcatcgcggccaatggaaccgatgtcacgctgtgc
gatagcggcctgatcaacgcgtcgggtacctgcaatgccgtttcaggttcgagcacgccg
ggccagtacgccctcaagctggtgaagaacgccgccgatggtttgacccacgtccaacag
aacggctcggatttcggcattttgagtttccaggcgggtgaccgcggtcccgttctggtc
atcgaccgctttggctacaaccaggacactcccccggtgctgcgcacgggcgtgttctac
gcgggcaagcagcaagtgctttcgggtaccgaactcaacggcacgtggacatgctcggat
cgaggggcggtcttcggcacggtcacgatcaatggcaccaccgtgaaaacggcggatacc
tccggggcgtccacggcagaaacgctgtacttcaacgacatcagcaccaacaccgggctg
gttgccgccaatggtgcagcgacctcggtcgtgaacggtcaggctcccagcgctggcgtg
atcgtgctgccgctgtcatccagcatgttcgctgtcgagcgcgacgccgcacagtccgtc
ggcgtgtgccgttga

DBGET integrated database retrieval system