KEGG   Ralstonia pickettii 12D: Rpic12D_0750
Entry
Rpic12D_0750      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: CW_7
Other DBs
NCBI-ProteinID: ACS62051
UniProt: C6BE91
Position
1:complement(780435..781391)
AA seq 318 aa
MVASTATQVEFTNKDTATATDLSTGKHQEWKYTLQGDVMTITMPWGNGQPRTFDLHRNGN
DFSGDLSIAPKSPADDARIEKIKQQEQEKKASEERSSPKGSPSDKSAYAAIKDIGDENNE
WYVWTAMAWNAKDQNDESKLGILSRVWYSTNDSFARQAVKDKELVRINKKLDDVKKIDYV
AVSESKGDPDFVSFDTISDKAGYDFDKKGFRVIGSICAGNLTSLGGKSGVRYRFIGDGPI
CFLPVADEEAAKKIEALRSTSQSGSLRIATTVYSKIAGMNGAELQLVPVGADYAVYKRSY
KPNTPDDLIATASYWPYK
NT seq 957 nt   +upstreamnt  +downstreamnt
atggtggctagcaccgccacgcaggtggaattcaccaacaaggacacggcgacggcgacg
gatctcagtacgggcaagcatcaagagtggaaatacacattgcaaggtgatgtaatgacg
atcaccatgccgtggggaaatggtcagcctcgcacattcgacctgcatcgcaacgggaat
gatttctctggtgatctgtcgatagcgccgaaatctccagccgatgatgctcggatcgaa
aaaatcaagcaacaggaacaggaaaaaaaagcttcagaagaacgctcgagcccaaaggga
tccccctctgacaaatcagcttatgcagccattaaagacataggcgatgagaataatgaa
tggtacgtctggacggcaatggcgtggaacgcaaaagatcagaacgatgaatccaagctg
ggcatcctttcgcgggtctggtacagcacgaacgatagcttcgcacgtcaggcggtaaag
gacaaagagctcgtgcgtatcaacaaaaaattggatgacgtcaagaagatcgactacgtc
gcggtcagcgaaagcaagggggaccctgatttcgtctcattcgataccatttcggacaaa
gctggctacgacttcgacaaaaagggattccgagttatcggaagcatatgcgccggaaat
ctcacgtcactcggagggaagtcaggtgttcgctatagattcattggtgatgggccaatc
tgcttcttgcctgttgccgatgaagaggctgcgaagaagatagaagcgctgcgctcgaca
tctcaatccggaagtctgcgtattgcgactaccgtgtactcgaagatcgctgggatgaat
ggcgcagagttgcagcttgtgccagtaggcgccgattacgccgtctacaagcgctcctac
aagcccaacacaccggatgatctgatcgctaccgcgagctattggccgtacaagtaa

DBGET integrated database retrieval system