KEGG   Ralstonia pickettii 12D: Rpic12D_0751
Entry
Rpic12D_0751      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: LPAM_2
Other DBs
NCBI-ProteinID: ACS62052
UniProt: C6BE92
Position
1:complement(781528..781842)
AA seq 104 aa
MRKTTAIAALFLPLFLAACGQKLSGTYASVSPQGLGNALDGAVILEFESGDKVVMKSPFG
STETNYSVDGNKLKIAANGQNMILEIQDDGSIAGWPGGMLLKKK
NT seq 315 nt   +upstreamnt  +downstreamnt
atgagaaaaaccacagcaattgcggcgttatttctacccctttttctggcggcatgtggt
caaaagctaagtggaacctacgcgtccgtctccccgcaaggattggggaatgctttggat
ggagccgtgattttggaatttgagtcgggtgacaaggtggtcatgaaatcaccattcggc
tctacagagaccaattattccgtggacgggaataagctcaaaattgcagccaatgggcag
aatatgattcttgagattcaggatgacgggagtattgccggatggcctggtggcatgctc
ttgaagaagaaataa

DBGET integrated database retrieval system