KEGG   Ralstonia pickettii 12D: Rpic12D_0752
Entry
Rpic12D_0752      CDS       T00925                                 

Definition
(GenBank) peptidase C14 caspase catalytic subunit p20
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Peptidase_C14 Sel1
Other DBs
NCBI-ProteinID: ACS62053
UniProt: C6BE93
Position
1:complement(781987..783426)
AA seq 479 aa
MYRLFLKKVLLLAALMMASTFAQLVHAANAVDIKHRYALVIGNAKYSVPANVLLNPVNDA
ALVSDALRKRGFQVTSLINQSRAQMEKAVDDFAGRAEGADLALVYYAGHAVAIDGINYLF
GVDLGMPLSGVNISLAQQSALSMKVILMALNRAKIRARLLVLDACRVNLTRGADQAGSLA
KVVPAGGELIAFSTQPGATAEDGFTQGGPKNSPYAYYFSSRLQALSPDEPVENFFKQVTG
DVQTVTQYRQIPSYSASLVGDVTFVSYRNTTTAAFGSVGVMMEQRRGVDPALSKNMLWMR
LDDWAIDIERSARNADALELKSMRARAEMGDVMAITELGMISGLGKIVPKDMVEAKRRFE
QAAKMGFPLAKTYLAAMLWLGKNTPAEIARARVEAEPLLREAWDGGSHRAARQLLWVQNL
LDKQPNPVDLKRYNDETYEYVRLGGDPLNMKMQKNGICPADMSVRECIIAHPEIPINEI
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgtatcgactttttctaaaaaaggtgttgctgcttgcggcattgatgatggcaagcact
ttcgcgcagcttgtccacgcggcgaatgctgtcgatatcaagcaccgctacgcattggta
ataggcaatgcaaaatacagcgttccggccaacgtcttgctcaatcctgtgaatgacgca
gcgcttgtgtcggatgcgttgcgcaagcggggtttccaagtaaccagcctcatcaatcaa
agcagagcacagatggagaaagcggttgacgacttcgctggtcgggccgaaggtgcggat
ttagcgctggtgtattacgcaggccatgccgtggcaatcgacgggatcaattatttgttt
ggcgtcgatctcggcatgccactgagcggcgtgaacattagtttggctcagcaaagcgca
ttaagcatgaaggtcatcttgatggcgctcaatcgcgccaagattcgagcgcgactgctg
gttctcgacgcatgccgggtcaacttgactcgcggggcggatcaagctggctccttggcg
aaagtggtaccagccggaggggagctcatcgctttttcgactcagcctggcgctacggcg
gaggatgggtttactcagggcggccccaaaaacagtccctatgcttactacttttcatcc
aggttgcaggcgctatcgccagacgagcccgttgagaatttcttcaagcaagtcactggc
gacgtgcaaacagtaacccaatatcgacaaatacccagttatagcgccagcttggttggt
gacgtgacttttgtcagctacaggaatactacaacggcggcattcggctcagttggcgtg
atgatggaacaaaggcgtggggtcgatccggcacttagcaagaacatgctctggatgcgt
ctggacgattgggccattgatatcgagcgatcagcgcgtaatgcggacgcgctggaattg
aaatccatgcgcgcaagggctgagatgggggatgtcatggcgatcaccgagctgggcatg
atctcaggcttgggaaaaattgtgcctaaggacatggtcgaagcaaaaaggcgttttgag
caagcggcaaaaatggggttccccttggccaagacatatctggctgcaatgctttggctt
ggtaaaaacacgccggccgagattgcccgggcccgtgtcgaggcggagccgctcctgcgg
gaagcatgggatggaggttcacaccgagcggcgaggcaacttctttgggtacagaatctt
ctggataaacaacccaacccggtcgatttgaaacgctacaacgacgaaacatatgagtat
gtcaggttaggtggtgatcccctgaacatgaagatgcaaaaaaatggtatttgtcccgcg
gacatgtcggtgcgtgaatgcataattgcccatcctgaaattccgattaatgaaatataa

DBGET integrated database retrieval system