KEGG   Ralstonia pickettii 12D: Rpic12D_0754
Entry
Rpic12D_0754      CDS       T00925                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rpf03021]
    Rpic12D_0754
Transcription machinery [BR:rpf03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Rpic12D_0754
SSDB
Motif
Pfam: Sigma70_r4_2
Other DBs
NCBI-ProteinID: ACS62055
UniProt: C6BE95
Position
1:complement(784069..784749)
AA seq 226 aa
MLTQQPKRHAIRDIDDFIRILHGDPRYALAFRNEAERHITLKLRRKFLRSSSEIVADAFN
TALVNFLQTKTFSAQAFLDGQPSQGWSAEELAHSKLGGYLYMGAKNALIQSWRRAGKNEI
AFDDEDDQDTTDSAATSINLKNLADTSLFSDPDAAYEHKTMLQRLLDCVGKLSETLRTTM
EFFLDDCSMEVISERQGINVATVKSRLHAARKLVVECGRKGVPNHV
NT seq 681 nt   +upstreamnt  +downstreamnt
atgctgacgcagcagcccaagcgccacgccatccgcgacatcgatgatttcatccgaatt
ctgcatggggatcctcgctatgctttggcatttcgtaatgaagccgagcggcacatcaca
ttgaagctgcgccgcaagtttctgcgcagctcctccgagatagtggctgacgcgttcaac
accgcactcgtaaattttttgcagaccaagaccttctctgcccaggcattcttggatggg
cagccttcccaagggtggtcggctgaagaattggcacacagcaaactcggtggttatctc
tacatgggtgcaaagaacgcgctcatccagtcctggcgtagggcaggcaagaatgaaatc
gcctttgatgacgaggacgatcaagacacaactgacagtgctgctaccagcatcaatctg
aaaaatctggcggatacgtcgctgttcagcgacccggatgcggcctacgagcacaagacc
atgctgcaacgcttactggactgcgtgggcaaactgagcgaaaccttgcgcacgaccatg
gaatttttcctggacgattgctcgatggaggtgatttcagagcggcaaggcataaacgtt
gccacggtcaaaagccgcctgcacgctgcgcgcaaactggttgtcgagtgtggtcgtaaa
ggtgtgcccaatcatgtctga

DBGET integrated database retrieval system