KEGG   Ralstonia pickettii 12D: Rpic12D_0756
Entry
Rpic12D_0756      CDS       T00925                                 

Definition
(GenBank) PfkB domain protein
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00030  Pentose phosphate pathway
rpf01100  Metabolic pathways
rpf01120  Microbial metabolism in diverse environments
rpf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rpic12D_0756
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     Rpic12D_0756
SSDB
Motif
Pfam: PfkB Phos_pyr_kin
Other DBs
NCBI-ProteinID: ACS62057
UniProt: C6BE97
Position
1:786609..787598
AA seq 329 aa
MSHTLDVITYGEAMAMFVATAPGPLAQATQFTKRIAGADLNVAVGLSRLGFRVGYVSRVG
QDSFGEYVRETLARERIDASCVAVDPHYPTGFQLKSRADDGSDPRVEYFRKGSAASRLSR
ADYVADYVLSARHLHLTGVAPAISASSCELAFHLAREMRAAGRSISFDPNLRPTLWRSAT
EMVTTLNALASLSNWVLPGLAEGQQLTGYDTPADIARFYLDRGARGVAIKLGASGAYYQT
ADGAEGVADGVRVERVVDTVGAGDGFAVGVVSALLEGLSAEQAVARGNRIGALAIQVIGD
SEGLPTRAALDVLEKTARLGCEPESIPSV
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtcgcatacgttggatgtcatcacctacggcgaagccatggcgatgttcgtggcgacg
gcgcccgggccgctcgcgcaggccacgcagttcaccaagcgcatcgcaggtgccgatctg
aacgtcgccgtcggcttgagccgcctcggctttcgcgtcggctatgtgagccgggtgggg
caggattcgtttggcgaatatgtgcgggaaacgctggcacgcgaacggatcgacgcctcg
tgtgtagcggtggacccgcactatccgacgggcttccagttgaagtcgcgcgccgacgat
ggcagcgacccgcgtgtcgaatacttccgtaaaggctcggccgccagccgcctctcccgc
gccgactatgtcgccgactatgtgctcagcgcgcgccatctgcatctgacgggtgtggcc
cccgccatttctgcgtcgtcgtgtgaacttgcgttccacctcgcgagggagatgcgtgcg
gccggtcgctcgatttcctttgacccgaacctgcgtccgacgctgtggcgttccgcaacg
gagatggtgaccacgctcaacgcgctggcgtcgctttccaattgggtgttgcctggcctg
gccgaggggcagcaactgaccggctatgacactccggctgacatcgcgcgtttctatctc
gaccgaggcgcgcgcggcgttgccatcaagctgggcgctagcggcgcttactaccagacc
gctgatggcgcggaaggcgttgccgacggcgtgcgtgtggagcgcgttgtcgacacagtc
ggcgcgggcgacggctttgcggtgggcgtggtgagcgcgctgcttgaagggctgtctgcc
gagcaggccgttgcgcgcggcaaccggatcggcgcgctggcgatccaggtgatcggcgat
tccgagggcctgccgacccgcgccgcgctcgatgtacttgaaaaaacggcccgcctgggg
tgcgagccggaatccattcccagcgtctaa

DBGET integrated database retrieval system