KEGG   Ralstonia pickettii 12D: Rpic12D_0757
Entry
Rpic12D_0757      CDS       T00925                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-ProteinID: ACS62058
UniProt: C6BE98
Position
1:787657..788937
AA seq 426 aa
MATQLAARRWWMIMPIVFITYSLAYLDRANYGFAAAAGINHDLGISQGLSSLIGALFFLG
YFFFQIPGAIYAERRSVKKLVFISLVLWGLCAALTGVVSDIPTLMAIRFVLGVVEAAVMP
AMLIYISNWFTKHERSRANTFLILGNPVTVLWMSVVSGYLVREFGWRHMFIAEGVPAIIW
AVCWWCLVQDKPAQAPWLNPQEKRDLEQALATEQAAIKPMRNYGEAFRSPVVIKLCAQYF
CWSIGVYGFVLWLPSIVKNGSSLGMVETGWLSALPYLAATIAMLAASWASDKVGSRRGFV
WPFLLVGAAAFAASFALGSTHFWMSYVLLVIAGAAMYAPYGPFFAIVPELLPKNVAGGAM
ALINSMGALGSFVGSYFVGYLNGATGSPLASYAFMSAALLAAVVLTLCVKPQPRDAYTLA
HPVPGK
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcaacgcaacttgctgcgcggcgctggtggatgatcatgccgatcgtctttatcacc
tacagcctggcctacctcgaccgcgcgaactatggcttcgcggcggcggccggcatcaat
cacgatctggggatcagccaggggctctcgtcgttgattggtgcgctgttcttcctcggc
tatttcttcttccagattcccggcgcgatctacgcagaacgccgcagcgtgaagaagctc
gtgttcatcagcctcgtgctgtggggcttgtgcgccgcgctcacgggcgtcgtgagtgac
attccaacgttgatggcgatccggtttgtactgggtgtggtcgaggcggccgtcatgccg
gcgatgctcatctacatcagcaactggtttaccaagcacgagcgttcgcgcgcgaataca
tttctgattctgggcaatcccgtgaccgtgctctggatgtcggtggtgtcgggctacctc
gtgcgcgagttcggctggcgccatatgttcatcgccgagggcgtgcccgccatcatctgg
gccgtgtgctggtggtgcctggtgcaggacaagcccgcgcaggcgccgtggctgaaccca
caggaaaagcgcgacctggaacaagccttggcgacggaacaggcggccatcaagccgatg
cgcaactatggcgaggccttccgctcgcctgtcgtcatcaagctgtgcgcgcagtacttc
tgctggagcatcggcgtctatggcttcgtgctgtggctaccgtccatcgtgaagaacggc
tcgtcgcttggcatggtcgagacgggctggctgtcggcgctgccgtatctggctgccacc
atcgcgatgctcgcggcgtcttgggcatccgacaaggtgggctcgcggcgcggcttcgtt
tggccgttcctgctggtgggcgcagcggcgtttgctgcatcgtttgctctcgggtccacg
catttctggatgtcgtatgtgctgctcgtgattgccggcgcggcgatgtacgcaccgtat
ggtccgttcttcgcgatcgtgccggagcttctgccgaagaacgtcgccggtggcgcgatg
gcgctgatcaacagcatgggtgctctcggttcgtttgtcggctcgtacttcgttggctac
ctgaacggtgccaccggctcgccgctggcgtcgtacgctttcatgagcgccgcgctcctc
gcagccgtagtgcttacgctttgcgtcaagccgcaaccgcgtgatgcgtacacgctcgcc
caccctgtgcctggaaaatga

DBGET integrated database retrieval system