KEGG   Ralstonia pickettii 12D: Rpic12D_0758
Entry
Rpic12D_0758      CDS       T00925                                 

Definition
(GenBank) Gluconate 2-dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00030  Pentose phosphate pathway
rpf00260  Glycine, serine and threonine metabolism
rpf00620  Pyruvate metabolism
rpf00630  Glyoxylate and dicarboxylate metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rpic12D_0758
   00620 Pyruvate metabolism
    Rpic12D_0758
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_0758
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic12D_0758
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     Rpic12D_0758
    1.1.1.81  hydroxypyruvate reductase
     Rpic12D_0758
    1.1.1.215  gluconate 2-dehydrogenase
     Rpic12D_0758
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN Gp_dh_N AdoHcyase_NAD
Other DBs
NCBI-ProteinID: ACS62059
UniProt: C6BE99
Position
1:788942..789916
AA seq 324 aa
MKPLVVAYKPLPEDVTAQLREHVELVQVDGAEALTEALTKAEGAIGASLKITPQMLDHAP
RLKAWSTISVGYDNFDVPDLTRRGIVLAHTPDVLTESTADTVFALILASARRVVELAEWV
RAGNWQRSIGPELYGTDVQGKTIGIVGLGRIGAALARRAAHGFRMHVLYTNRHPHPEAEA
QYGARRVTLDTLLAEADFVCLQVPLTPETQHLIGAAELAKMKRSAILINASRGAVVDEAA
LIHALRNGTIRGAGLDVFEHEPLTPDSPLLAMKNVVALPHIGSATHETRHAMARCAADNL
IKALAGTLRENLVNPQVLEHARTS
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaaaccgcttgtcgttgcctacaagcctttgcccgaagatgtcacggctcagttgcgc
gagcatgtcgaactcgtgcaggttgacggtgccgaggcgttgaccgaggcgcttacaaag
gccgagggtgcgatcggtgcgagcctgaagatcacgccccaaatgctcgaccacgcgccc
cgcctcaaggcgtggtctacgatctccgtcggctatgacaatttcgatgtgcccgatctc
acgcgtcggggcatcgtgctggcgcacacaccggatgtgttgaccgagtcgaccgccgat
accgtgttcgcgctcattctcgcgtcggcgcgtcgtgtcgtggagctggccgagtgggtc
cgggccggtaactggcagcgcagcatcgggccggagctttacggcacggacgtccagggc
aagacgatcggcatcgtcgggctgggtcggatcggcgccgcattggcccgccgtgcggcg
cacgggtttcggatgcacgtgctctacacgaaccggcatccgcatcccgaggccgaagcg
cagtacggcgcgcgccgcgtgacgctcgacacgttgctggccgaagcggattttgtttgc
ctgcaggtgccgctgacgccggaaacgcagcacctgatcggcgcggcagaactggcgaag
atgaagcgcagtgcgattctcatcaatgcatcgcgtggggccgtcgtcgacgaagcggcg
ctcattcatgccttgcgcaatggcacgatccgcggcgccgggctcgatgtgttcgagcac
gagccgctgacccccgactcgccattgctggcgatgaagaacgtggtggccttgccccat
atcggctccgcaacgcacgagacgcggcacgccatggcgcgctgcgcggctgacaacctg
atcaaggcgctggccggcacgttacgtgaaaacctggtcaatccacaggtgctggagcac
gcgcgcacctcgtga

DBGET integrated database retrieval system