KEGG   Ralstonia pickettii 12D: Rpic12D_0762
Entry
Rpic12D_0762      CDS       T00925                                 

Definition
(GenBank) Taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00430  Taurine and hypotaurine metabolism
rpf00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rpic12D_0762
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Rpic12D_0762
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     Rpic12D_0762
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: ACS62063
UniProt: C6BEA3
Position
1:792906..793808
AA seq 300 aa
MSDAVVTPDAPAVHTARFHIRRLPDAPLGAEVLGLGDASDLSDADIAAIRQAWLAHDGLL
VFRDVEFTPQAQVAFSRRFGPQQVHVLNQFHLSGYPEILVVSNVVENGKPIGLGDAGRDW
HSDLSYKPLPSLGSMLLTRELPEEGGDTLFANMVRAYETLPANLKRVIEGRRAVHSYVYR
YDRLRALSTWRPPLTQAQRDAVPPVDHPVVRTHPETGKRALFVNEGFTSHIIGLPEDEST
SVLEQLFAHSVRADNVYTHQWRPGDMLFWDNRSTIHFAPGCPDKYRRTLHRTTIEGDVPA
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtccgacgccgttgttaccccggatgctcctgccgtccacacagcccgcttccacatt
cgccgcctgcccgacgcgccgcttggcgcagaggttctcggcctgggcgatgcatccgac
ttgtctgacgcggacatcgccgccatccgccaagcgtggctcgcgcatgacggcctgctc
gttttccgtgacgtcgaattcacgccgcaggcgcaagttgccttcagccgccgcttcggc
ccgcagcaggtgcatgtgctgaaccagtttcatctgagcggctatccggaaatcctggtc
gtttccaacgtggttgagaacggcaagccgatcggcctgggcgatgcagggcgggattgg
cattcagacctgtcgtacaagccgctgccgagcctcggttcgatgctgctcacgcgcgag
ttgccggaagagggcggcgatacgctgttcgccaacatggtgcgcgcctatgaaacgctg
ccggccaatctcaagcgcgtcatcgaaggccgccgtgcggtgcattcgtatgtgtaccgc
tatgaccgactgcgcgcgctgtcgacctggcgtccgccgctcacgcaagcgcagcgcgac
gccgtgccgccggtcgatcaccccgttgtgcgcacgcatccggaaacgggcaagcgtgcg
ctcttcgtcaacgagggcttcacctcgcacatcatcggcttgccggaagacgaaagcacc
agcgtgctggagcagctcttcgcccacagcgtccgcgccgacaacgtctacacgcaccag
tggcgccccggcgacatgctgttctgggataaccgctccaccatccactttgcgcccggc
tgcccagacaagtatcggcgcacgctgcatcgcacgaccatcgaaggcgacgtgccggct
tag

DBGET integrated database retrieval system