KEGG   Ralstonia pickettii 12D: Rpic12D_0764
Entry
Rpic12D_0764      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02069  putative ABC transport system permease protein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpf02000]
    Rpic12D_0764
Transporters [BR:rpf02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter
    Rpic12D_0764
SSDB
Motif
Pfam: UPF0014
Other DBs
NCBI-ProteinID: ACS62065
UniProt: C6BEA5
Position
1:complement(794283..795092)
AA seq 269 aa
MNGQDLSLSAWQVGIAAALILVNGALSVGLGLGLERRLAWAAVRTVVQLLAVGFVLEWVF
AHAHWAVVLGIVAVMTLIAGHATGSRGARSYTGLRLDGTLSVFGSTWLIGAIGLVAVLHA
RPWYEPQYAIPIMGMILGNTLTGVSLALERMTGELTATRDQVETILALGGTRWEAARNAA
RTAVRAGMTPIINQMTVVGVVSLPGMMTGQVLAGQSPLEAVRYQIVIMFLLAASSGLGTV
AAVLLAYRRLFSREHQLLTARITQIGGAK
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaacggccaggacctctccctttccgcctggcaggtcggtattgcggctgcactgatc
ctcgtgaatggcgcactgtccgttggactgggcctcgggctcgagcgacgcctggcgtgg
gcggccgtgcgcaccgtggtgcaattgctggcggtgggcttcgtgctcgaatgggtattc
gcccacgcgcattgggcggtagtgctgggcatcgtggctgtaatgacgctgattgcgggg
cacgcaaccggcagccgcggcgcgcgcagttacacgggcttgcggctggacggtacgttg
tcggttttcggcagcacatggctgatcggcgcgatcgggctggtggccgtgctgcatgcg
cgcccgtggtatgagccgcaatatgccatcccgatcatggggatgattcttggcaacacg
ctcaccggcgtaagcctggcgctcgagcgcatgaccggtgagctgactgccacgcgcgac
caagtggagacgattcttgcgctcggcggcacgcgctgggaagcggcgcgcaacgcagcg
cgaacggccgttcgcgccggcatgacaccgatcatcaaccagatgaccgtggtgggcgtg
gtgagtctgcccggcatgatgacgggccaggtgctggcggggcagtctcctttagaggcc
gtgcgctaccagatcgtcatcatgttcctgctggcggcatcttccgggctggggacggtt
gcggccgtgctgctggcctatcgccggctgttcagccgtgagcaccagttgctgactgca
cgcatcacacaaatcggcggagcgaaatag

DBGET integrated database retrieval system