KEGG   Ralstonia pickettii 12D: Rpic12D_0765
Entry
Rpic12D_0765      CDS       T00925                                 

Definition
(GenBank) ABC transporter related
  KO
K02068  putative ABC transport system ATP-binding protein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpf02000]
    Rpic12D_0765
Transporters [BR:rpf02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter
    Rpic12D_0765
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 NACHT AAA_22 AAA_16 SMC_N AAA_28 SbcCD_C AAA_25 AAA_30 IstB_IS21 TsaE RsgA_GTPase AAA_18 Mg_chelatase DAP3 AAA_23
Other DBs
NCBI-ProteinID: ACS62066
UniProt: C6BEA6
Position
1:complement(795089..795763)
AA seq 224 aa
MLAATHLQRRDARAGVTLLQSATLAVQAGDRIALTGPSGAGKSVLLRALALLDPLDDGQV
TWHGQAIGPRAVPAYRCHVAYVRQRPALPPGTVEDNLRLPYQLHVRRQSTGFDRDAAIAL
LVGAERDASFLDKNAADLSGGEAQIAALVRTLQTRPTVLLLDEPTAALDPASARAVEALL
QHWFAQAPERHAWMWVTHDSAQAERIGRQHWKMVAGQLDTGLER
NT seq 675 nt   +upstreamnt  +downstreamnt
atgctggccgccacccacctccaacgccgcgatgcacgcgccggtgtcacgctgctgcaa
tctgccacgcttgctgtgcaggcaggcgaccgcattgcgctgaccgggccatccggcgcg
ggcaagagcgtgctgctgcgcgcgctggcgctgctcgatccgctcgatgatgggcaagtg
acatggcatggccaagcgatcggcccgcgcgcggttccggcctatcgctgtcacgtggcg
tacgtgcgccagcgcccagcgctgccgcccggtacggtggaggacaacctgcgcctgccc
tatcagctgcacgtgcggcgccaaagcaccggcttcgatcgggacgccgctatcgccttg
cttgtgggtgccgagcgcgacgccagctttctcgacaaaaacgccgccgatctttccggc
ggtgaagcacagatcgcggcgctggttcgcacactacagacacggccgaccgtcctgctg
ctggacgagcctacggcggcccttgaccccgcctctgcgcgtgcggtcgaggcgctgttg
cagcattggtttgcgcaggcacccgagcggcatgcgtggatgtgggtgacacacgattcg
gcgcaagcagagcgcatcggccggcagcattggaagatggttgccgggcaactcgacacg
gggctcgagcgatga

DBGET integrated database retrieval system