KEGG   Ralstonia pickettii 12D: Rpic12D_0766
Entry
Rpic12D_0766      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: CCSMST1
Other DBs
NCBI-ProteinID: ACS62067
UniProt: C6BEA7
Position
1:796074..796439
AA seq 121 aa
MEADKVQVAHPWWQPGVFASALAIFLWICAELPPDMLGTIFHAGTSPDSLRHVGDTLFVI
GWTASGALMWSGRRRVAHDADVTAQPAEAEVGATGQPHGLAGLRQSMARRWERMRHPIPL
H
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggccgacaaagtgcaagttgcccacccatggtggcagccgggagtctttgcatct
gcgctagcgatttttttgtggatctgcgcggagctgcctcccgatatgcttggcaccatc
ttccatgcgggtacgtcgcccgattctcttcggcatgttggtgacaccctgttcgtgatt
ggctggaccgccagcggcgcgctgatgtggagtggccgacggcgtgtcgcgcatgacgct
gacgtgacagcgcagccggctgaggcggaagttggcgccactggtcaaccgcacgggctt
gctggtttgcgccagagcatggcccggcggtgggagcgcatgcgtcatccgattccgctg
cactga

DBGET integrated database retrieval system