KEGG   Ralstonia pickettii 12D: Rpic12D_0767
Entry
Rpic12D_0767      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3318 DUF533
Other DBs
NCBI-ProteinID: ACS62068
UniProt: C6BEA8
Position
1:complement(796501..797028)
AA seq 175 aa
MTDPTEHAPSPGTSVNEPASSARHHVRPSRRGAETRLPLSVRKELLLTRAALERYDYAQA
RHDVHRASSRTFSLGGLGALLPSLFRPLARPNSLMRTLGIAREYPLLGTVLSLAYAGLRR
TVIGRITRKLGKVGIVAGAAWWGYKKWQEAQGEHAGAPTSAPNADAEEIIPGSTS
NT seq 528 nt   +upstreamnt  +downstreamnt
atgactgatccgaccgaacacgcgccgtcaccgggcacatccgtgaacgaacccgcatcg
agcgcgcggcaccatgtgcggccgtcacgccgcggcgccgaaacacgcctgcccttgagc
gtgcgcaaggaattgctgctcacgcgcgccgcgctggagcgctacgactacgctcaagcc
cgccacgatgtccatcgcgccagtagccgtaccttcagcctgggcggcctcggagcattg
ctgccaagcctgttccgcccgctggcccggccgaacagcctgatgcggacgctgggcatt
gcgcgtgagtatccgctgctgggcactgtactgtcgctcgcgtatgcaggattgcgccgc
accgtcatcggccggatcacgcgcaagctcggcaaggtggggatcgtggccggagcggcc
tggtggggctacaagaaatggcaggaggcacaaggcgagcacgccggcgcgccaacctcg
gcgcccaacgccgacgcggaggagatcatcccaggcagcacctcttga

DBGET integrated database retrieval system