KEGG   Ralstonia pickettii 12D: Rpic12D_0768
Entry
Rpic12D_0768      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Phage_holin_3_6 DUF4131
Other DBs
NCBI-ProteinID: ACS62069
UniProt: C6BEA9
Position
1:complement(797025..797402)
AA seq 125 aa
MTDDTSPKLFASLKKLAGTVVSMLQTRLELASVELAEEKERLLGTAFLGMLAVSLIALSI
MTLTALVVILCWDTYRWQSLAVMAALYALGAAACLWKVRSLLRDAPPLFEATLAELDKDR
EILRR
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaccgacgacaccagccccaagctgttcgcttccttgaagaaactggccggcacggtc
gtctcgatgctgcagacgcggctcgagctggcgagcgtcgagctggctgaagaaaaagaa
cggctgctcggcaccgccttcctgggcatgttggccgtgagcctgatcgccctgtccatc
atgacgctgacggcgctggtggtcatcctgtgctgggatacgtatcgctggcagtccctg
gccgtgatggcggcgctgtatgcgctgggcgctgcagcgtgcctgtggaaggtgcgttcg
ctgctgcgcgacgcaccgccgctgttcgaggccacgctggccgaactagacaaagaccgg
gagatcctgcgccgatga

DBGET integrated database retrieval system