KEGG   Ralstonia pickettii 12D: Rpic12D_0769
Entry
Rpic12D_0769      CDS       T00925                                 

Definition
(GenBank) protein of unknown function DUF883 ElaB
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF883_C DUF883 Phage_holin_2_1
Other DBs
NCBI-ProteinID: ACS62070
UniProt: C6BEB0
Position
1:complement(797543..797935)
AA seq 130 aa
MLANKRADILTIELPPVTEDPTMTNTSPNLADSVNKEKLMTDVKTVLSDAETLLKQAAST
SGEKAAELRERGMGMLRQAKEKAQDLQDAVVHKSKAAARATDDYVHDHPWQAVGVAAGVG
LLIGLLLNRK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgctagcgaataagcgcgccgacatattgacgattgaactaccccccgtcaccgaggac
ccgaccatgacgaacacttcccccaacctggccgattccgtcaataaggagaaactgatg
accgacgtgaagactgtactgtccgacgctgaaaccctgctcaaacaagctgcgtccacc
agcggcgaaaaggccgccgagttgcgcgagcgcggcatgggcatgctccgccaagccaag
gaaaaggcgcaggacctgcaagacgcggtcgtccacaagagcaaggctgccgcacgcgcc
accgacgactacgtccacgaccacccatggcaagccgtgggcgtggcggccggcgtgggc
ctgctgatcggcctgctgctcaaccgcaagtaa

DBGET integrated database retrieval system