KEGG   Ralstonia pickettii 12D: Rpic12D_0771
Entry
Rpic12D_0771      CDS       T00925                                 

Definition
(GenBank) Xanthine/uracil/vitamin C permease
  KO
K06901  adenine/guanine/hypoxanthine permease
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpf02000]
    Rpic12D_0771
Transporters [BR:rpf02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Rpic12D_0771
SSDB
Motif
Pfam: Xan_ur_permease AcrZ
Other DBs
NCBI-ProteinID: ACS62072
UniProt: C6BEB2
Position
1:complement(798922..800304)
AA seq 460 aa
MAEQSIPSSTELGTAGIADARAIDRYFQISARGSTQKREVVAGITTFMAMVYAVFVVPGM
LGKAGFDTSAVFVAVCLTTAFGSLLMGLWAKLPIAIGCAISLTAFMAFGLVLGQKLSPEI
ALGAVFLMGVVFTAISATGVRSWILRNLPSGVAHGTGIGIGLFLLLIASNDVGLVVKNAG
AGLPVALGHVTAFPVMMSVLGLAAIFGMERRRVPGGILIVIIAISVLGLIFDPAVKFTGV
FAVPSLAAAGHASLIGTMDIRGALTAAVLPSVLALVMTAVFDATGTIRAVAGQAGLLNDK
GHIINGGRALTADSISSIFSAFFGGAPAAAYIESTVGVAAGGKTGLTAVVVGLMFLAVMF
FSPLAGLVPSYATAPALMYVGLLMLSSVSKLHMDDMVDALSGLVCAVFIVLTCNIVTGIM
LGFSTLVIGRLVAGEWRKLNIGTVAIAAALVAFYAGGWAI
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggctgaacagtccattccgtcgtcgacggaacttggcaccgctggcatcgccgatgcg
cgtgccattgatcgctatttccagatttctgcacgcggcagcacgcaaaagcgcgaggtc
gtggctggcatcacaaccttcatggcgatggtctacgccgtatttgtcgtgcccggcatg
ctgggcaaggccggctttgataccagcgcagtgttcgtcgcggtgtgtctgaccaccgcc
ttcggctccctgctcatgggcttgtgggccaagctgccgatcgccatcggctgcgcaatc
tcgctgaccgcgttcatggcctttggcctggtgctggggcaaaagctgtcgccggaaatc
gcgctcggcgcggtgttcctgatgggtgtggtcttcaccgccatctcggccacgggcgtg
cgctcgtggattctgcgcaacctgccttcgggcgtggcacacggcacgggcatcggcatt
ggcctgttcctgctgctgatcgcgtccaacgacgtggggctggtcgtcaagaacgccggt
gcgggcctgcccgttgcactgggccacgtcactgccttcccggtgatgatgtcggtgctg
gggctggccgccatcttcggcatggagcgtcgtcgcgtgccgggcggcatcctgatcgtg
atcattgccatctcggtcctgggcctgatctttgacccggccgtgaagttcaccggcgtg
ttcgccgtgccctcgctcgccgctgcagggcatgcctcgctgatcggcacaatggatatt
cgcggcgcacttacggccgccgtgctgcccagcgtgctggctctggtgatgaccgccgtg
ttcgatgccaccggcacgatccgcgcagtcgccggccaggccgggctgctcaacgacaag
ggccacatcatcaacggtggtcgcgcgctcacggccgattcgatcagctcgatcttctcg
gcgttcttcggcggggctcctgcggccgcctacatcgagtcgacggttggcgtggcggct
ggcggcaagacgggcctgacggccgtggtggtcggcctgatgttcctggccgtgatgttc
ttctcgccgctggcgggactggtgccgtcgtacgcaacggccccggcgctgatgtatgtc
ggcttgctgatgctatccagcgtgagcaagctgcacatggacgacatggtcgacgcgctg
tccgggctggtctgcgccgtgttcatcgtgctgacctgcaatatcgtcaccggcatcatg
cttggcttcagcacgctggtcatcggccgcctggtggccggcgaatggcgcaagctgaac
atcggcaccgtggcgatcgccgctgcactggtcgcgttctacgcaggcggctgggcgatc
tga

DBGET integrated database retrieval system