KEGG   Ralstonia pickettii 12D: Rpic12D_0772
Entry
Rpic12D_0772      CDS       T00925                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00071  Fatty acid degradation
rpf00310  Lysine degradation
rpf00362  Benzoate degradation
rpf00380  Tryptophan metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rpic12D_0772
  09105 Amino acid metabolism
   00310 Lysine degradation
    Rpic12D_0772
   00380 Tryptophan metabolism
    Rpic12D_0772
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic12D_0772
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     Rpic12D_0772
SSDB
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Other DBs
NCBI-ProteinID: ACS62073
UniProt: C6BEB3
Position
1:complement(800715..801908)
AA seq 397 aa
MTARNAFNWADPLLLDQQLTDDERMVRDAAASYCQDKLMPRVLESFRHEKTDASIFREMG
ELGLLGPTIPEQYGGPGLNYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIYEFGSEAQ
KQKYLPKLVTGEWIGCFGLTEPNHGSDPASMITRAKKVDGGYSLSGAKMWITNSPIADVF
VVWGKLPNDNGEDEIRGFILEKGWKGLTAPAIHGKVGLRTSITGEIVLDEVFVPEENLMP
GVRGLKGPFTCLNSARYGIAWGALGAAEACWHIARQYVLDRKQFGRPLAANQLVQKKLAD
MQTEITLGLQGCLRLGRMKDEGTAAVEITSIMKRNSCGKSLDIARVARDMLGGNGISDEF
GVIRHVVNLEVVNTYEGTHDIHALILGRAQTGIQAFF
NT seq 1194 nt   +upstreamnt  +downstreamnt
gtgaccgctcgcaacgccttcaattgggccgaccccctgctgctcgaccaacaactgacc
gacgacgaacgcatggtgcgcgacgccgccgcgtcgtactgccaggacaagctgatgccg
cgcgtgctggagtcgttccggcacgaaaagaccgacgcgtcgatctttcgtgagatgggc
gagctgggcctgctgggcccgacgattcccgagcagtacggcggcccgggcctgaactac
gtcagctacggcctgatcgcacgtgaagtcgaacgggtggattcaggctaccgctcgatg
atgagcgtgcagtcgtcgctggtgatggtgccgatctacgaattcggcagcgaggcgcaa
aagcagaaatacctgccgaagctggtgaccggcgagtggatcggctgctttggcctgact
gagccgaaccacggttccgaccctgcctcgatgatcacgcgcgccaaaaaagtcgacggc
ggctactcgctgtcgggcgccaagatgtggatcaccaattcgcccatcgccgacgtgttt
gtcgtatggggcaagctgccgaacgacaacggcgaggatgaaatccgcggcttcatcctg
gagaaaggctggaagggactgacggcgcccgctatccacggcaaggtcggcctgcgtacg
tcgatcaccggtgaaatcgtgctcgacgaagtgttcgtgccggaagagaacctgatgccg
ggcgtgcgcggcctaaagggtccgttcacgtgcctgaactcggcgcgctacggcatcgcg
tggggtgcgctgggcgctgccgaagcctgctggcacatcgcacgccagtacgtgctggat
cgcaagcagttcggccgcccgctcgccgccaaccagctcgtgcaaaaaaagctggccgac
atgcagaccgaaatcacgctcggcctgcaaggttgcctgcgcctgggccgcatgaaggac
gaaggcacggccgcggtggaaatcacctcgatcatgaagcgcaactcgtgcggcaagtcg
ctcgacatcgcccgcgtggcgcgcgacatgctgggcggcaacggcatctccgacgagttc
ggcgtgatccgccacgtggtgaatctggaagtcgtgaatacctacgagggcacgcacgat
atccacgcgctgatcctcggccgcgcacagaccggcattcaggcgttcttctga

DBGET integrated database retrieval system