KEGG   Ralstonia pickettii 12D: Rpic12D_0774
Entry
Rpic12D_0774      CDS       T00925                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00380  Tryptophan metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Rpic12D_0774
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     Rpic12D_0774
SSDB
Motif
Pfam: Trp_dioxygenase DUF2779
Other DBs
NCBI-ProteinID: ACS62075
UniProt: C6BEB5
Position
1:complement(803126..804001)
AA seq 291 aa
MSNPNQPAASGCPMHAAQGEGWHDAQLDFSKSMSYGDYLALDQILNAQHPRSPDHNEMLF
IVQHQTTELWMKLMLHELRAARDCVRNDNLPPAFKMLARVSRIMDQLVQAWNVLATMTPP
EYSAMRPHLGQSSGFQSYQYREIEFILGNKNAAMLKPHAHRTEHYEQVKAALETPSLYDE
AVRYMARHGFAFDADCIERDWSRPVTYNASVEAAWLEVYRDPTHHWELYELAEKFVDLED
AFRQWRFRHVTTVERVIGFKRGTGGTEGVGYLRKMLDVVLFPELWKLRTDL
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtcgaacccgaaccaacccgcagcatcgggctgccccatgcatgccgcccagggcgaa
ggctggcacgacgcgcagctcgatttttcaaaatcgatgagctatggcgactacctcgcg
ctcgaccagatcctgaacgcgcagcatccgcgctcgccggatcacaacgagatgctcttc
atcgtccagcaccagaccaccgagctgtggatgaagctgatgctgcacgagctgcgcgcc
gcgcgggattgcgtgcgcaatgacaacctgccgcctgcgttcaagatgctggcgcgcgtg
tcgcgcatcatggatcagctggtgcaggcgtggaacgtgctcgccacgatgacgccgccg
gagtactcggccatgcgtccgcacctcgggcaatcgtcaggctttcagtcgtatcagtac
cgcgagatcgagttcatcctcggcaacaagaacgcggcgatgctcaagccgcacgcgcat
cgcaccgagcattacgaacaggtcaaggctgcgttggaaacgccgtcgctgtacgacgag
gcggtgcgttacatggcgcgtcacggctttgcattcgacgcagattgcatcgagcgtgac
tggtcgcgtcccgtgacttacaacgcctcggtggaagcggcgtggctggaggtctatcga
gacccgacgcaccactgggagctgtacgagctggctgagaagttcgtcgatctggaagat
gcgttccggcaatggcgcttccggcatgtgaccacggtcgagcgcgtgattggcttcaag
cgtggcacgggcggcaccgagggcgtcggttacctgcggaagatgctggatgtggtgttg
tttccggagctttggaagttgcggacggacctttga

DBGET integrated database retrieval system