KEGG   Ralstonia pickettii 12D: Rpic12D_0775
Entry
Rpic12D_0775      CDS       T00925                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00380  Tryptophan metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Rpic12D_0775
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Rpic12D_0775
SSDB
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ACS62076
UniProt: C6BEB6
Position
1:complement(804003..805256)
AA seq 417 aa
MTITRNSCVERDAADPIAALRDAFALPDGAIYLDGNSLGARPKAALARAQEVVANEWGDG
LIRSWNQAGWFELPRRLGNKLAPLIGAREDEVVVTDTTSINLFKVLAAAIRVQREDAPAR
KIIVSETHNFPTDLYIAEGLADLLRDGYKLRLIDSPEELEGALGDDVAVTMLTHVNYKSG
HMYDMAAVSALAHKHGALAIWDLAHSAGAVPVDLHAGGADYAIGCTYKYLNGGPGSPAFV
WVAPALRERFWQPLSGWWGHARPFAMESRYDADAGIGRFLCGTQPITSMAMVECGLDIFA
QTSMAALRAKSLALTDLFITLVETRCAGFPLTLVTPRNHAIRGSHVSYEHPNGYAVVQAL
IARGVIGDYREPRIMRFGFTPLYTSFADVWDAVEILRDVLETGAWQSAQFNERTLVT
NT seq 1254 nt   +upstreamnt  +downstreamnt
gtgaccatcacccgcaactcctgcgtcgaacgcgacgcggccgatccgatcgccgcgctg
cgcgacgcctttgcgctgcccgacggcgcgatttatctcgacggcaactctctgggcgcc
cgcccgaaagctgcgctcgcccgcgcgcaggaagtcgtcgccaatgaatggggcgatggc
ctgatccgcagctggaaccaggccggctggtttgagttgccgcgccgcctgggcaacaag
cttgccccgctgattggtgcgcgcgaagacgaagtcgtcgtcaccgacaccacatcgatc
aatctcttcaaggtgctggccgccgcgattcgcgtgcagcgcgaagacgcgcccgcccgc
aagatcatcgtgtcggaaacgcataactttccgaccgacctctacatcgctgaaggcctg
gccgacctgctgcgcgacggctacaaactgcgcctgatcgactcgccggaagagctggaa
ggcgcgctgggcgacgacgtcgccgtcaccatgctgacgcacgtgaactacaagagcggg
cacatgtacgacatggcggccgtctcggcgctggcgcacaagcacggcgcgctggccatc
tgggatctggcgcattcggcgggcgctgtgcccgttgacctgcacgcaggcggcgcggat
tacgccatcggctgcacctacaaatacctgaatggcggccctggctcgccggccttcgtg
tgggtggcgcccgcgctgcgcgaacgcttctggcagccgctgtccggctggtggggccat
gcgcggccgttcgcgatggagtcgcgctacgacgccgatgccggcatcggccgcttcctg
tgcggcacgcagccgatcacgtcgatggcgatggtggaatgcgggctcgacatcttcgcg
cagacgtcgatggccgccctgcgcgccaagtcgctggcgctcaccgacctcttcatcacg
ctggtggaaacgcgctgcgcaggctttccgctcacgctcgtcacgccgcgtaaccacgcc
atccgcggcagccatgtcagctacgaacaccccaacggctatgccgtggtgcaggcgctg
atcgcgcgcggcgtgatcggcgactaccgcgagccgcgcatcatgcgcttcggtttcaca
ccgctgtatacgagctttgccgatgtgtgggacgccgtggaaattctgcgcgatgtgctg
gaaaccggcgcatggcaatcggcccaattcaacgaacgtacgctggtgacctga

DBGET integrated database retrieval system