KEGG   Ralstonia pickettii 12D: Rpic12D_0776
Entry
Rpic12D_0776      CDS       T00925                                 

Definition
(GenBank) arylformamidase
  KO
K07130  arylformamidase [EC:3.5.1.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00380  Tryptophan metabolism
rpf00630  Glyoxylate and dicarboxylate metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_0776
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Rpic12D_0776
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.9  arylformamidase
     Rpic12D_0776
SSDB
Motif
Pfam: Cyclase Cortexin
Other DBs
NCBI-ProteinID: ACS62077
UniProt: C6BEB7
Position
1:complement(805302..805931)
AA seq 209 aa
MERTLWDISPALSPATPTWPGDTPFSQEIAWKLEGDCPVNVGRITLSPHTGAHADAPLHY
RADGTAIGQVPLDAYLGPCRVIHCVGVARVEPEHVREALTCTPPRVLLRTYAQMPQTAWD
DDFAAVAPETIALMAAHGVKLIGVDTASLDPQTSKTMDAHHAVGKHGLAILEGLVLDDVP
AGDYELIALPLKFATLDASPVRAVLRSLP
NT seq 630 nt   +upstreamnt  +downstreamnt
ttggaacgcactttgtgggacatcagccccgccctctcgcctgccacgcccacttggccc
ggcgatacgccgttttcgcaggaaattgcgtggaagctcgaaggtgactgcccagtcaac
gtcggacgcatcacgctctcgccgcacacgggtgcgcatgccgatgccccgctgcactac
cgcgcggatggcactgccatcggccaggtgccgctggacgcctacctgggcccatgccgc
gttatccactgcgtaggtgtagcgcgcgtcgagccggaacacgtgcgggaagcgctgacc
tgcacaccgccccgcgtgctgctgcgcacgtacgcacagatgccgcaaaccgcgtgggac
gacgactttgccgccgttgcgcccgagacgatcgcattgatggccgcgcacggcgtcaag
ctcattggcgtcgacaccgcctcgctcgacccgcagacctccaagaccatggacgcgcac
cacgccgtgggcaaacacggcctcgccatcctcgaagggctcgtgcttgacgacgtgccc
gccggcgattacgaactgatcgccctgccactcaagttcgccacgctcgatgcgagtccg
gtgcgcgccgtgctgcgcagcctcccctga

DBGET integrated database retrieval system