KEGG   Ralstonia pickettii 12D: Rpic12D_0777
Entry
Rpic12D_0777      CDS       T00925                                 

Definition
(GenBank) transcriptional regulator, AsnC family
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rpf03000]
    Rpic12D_0777
   03036 Chromosome and associated proteins [BR:rpf03036]
    Rpic12D_0777
Transcription factors [BR:rpf03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    Rpic12D_0777
Chromosome and associated proteins [BR:rpf03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Rpic12D_0777
SSDB
Motif
Pfam: AsnC_trans_reg HTH_24 HTH_AsnC-type HTH_20 MarR HTH_11 HTH_IclR MarR_2 Rrf2 HTH_Crp_2
Other DBs
NCBI-ProteinID: ACS62078
UniProt: C6BEB8
Position
1:806080..806607
AA seq 175 aa
MQLDTTDLRILQVLQEDGRISNQDLAERVALSPSACLRRVRMLEEGGAITGYRAQLGRAA
LGLELEAIVQVSMRQDVTGWHETFMAAVQSWPEIVAAYIITGDCNYILRVQAPNLQHYSE
FIIERLYKTPGVMDIRSNIVLRTIKDRDGGLALLMEARGVRPLEGKATGKGGRAK
NT seq 528 nt   +upstreamnt  +downstreamnt
atgcaactcgataccaccgatctgcgcattctgcaggtgttgcaggaagacggccgcatc
agcaaccaggatttggcggagcgcgtcgcgctgtcgccgtcagcgtgcctgcggcgggtg
cggatgctggaagagggcggcgccatcaccggttatcgggcgcaactgggccgcgccgcg
ctcgggctggaactggaagcgatcgtgcaggtgtcgatgcgccaagacgtgacgggctgg
cacgagacgttcatggccgccgtgcagagttggcccgagatcgtggccgcttacatcatc
actggggattgcaactacatcctgcgcgtgcaggcgcccaacctgcagcactactcggag
ttcatcatcgagcggctgtacaagacgcctggcgtgatggacatccgctcgaatatcgtt
ctgcgcaccatcaaggaccgcgacggcggtctggcgctgttgatggaagcgcggggcgtg
cgtccgctcgagggcaaggcgacgggcaagggcgggagagcaaagtag

DBGET integrated database retrieval system