KEGG   Ralstonia pickettii 12D: Rpic12D_0778
Entry
Rpic12D_0778      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3079
Other DBs
NCBI-ProteinID: ACS62079
UniProt: C6BEB9
Position
1:806696..806902
AA seq 68 aa
MAKKFPLHPVHPERICWGCDKYCSTDALGCGNGSGRTQHPAELLGDDWYEFGDWGIDADA
PQKPGTPA
NT seq 207 nt   +upstreamnt  +downstreamnt
atggccaagaagtttccgctgcatcctgtgcaccccgagcgcatctgctggggctgcgac
aagtattgctccaccgacgccctgggctgcggcaacggctcgggccgcacgcagcacccc
gccgagctgctcggcgacgactggtatgaattcggcgattggggcatcgacgcggacgcg
ccgcagaaaccaggcacgcccgcctaa

DBGET integrated database retrieval system