KEGG   Ralstonia pickettii 12D: Rpic12D_0780
Entry
Rpic12D_0780      CDS       T00925                                 

Definition
(GenBank) transcriptional regulator, TrmB
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: RepL MarR_2 HTH_24 TrmB HTH_Crp_2 MarR Mnd1 Phage_rep_O Ribosomal_S25 Cro Sigma70_r4 HTH_5 TFIIE_alpha RNA_pol_Rpc34 HTH_37 DUF4423 HTH_20 Sigma54_CBD pXO2-72 Penicillinase_R Rio2_N
Other DBs
NCBI-ProteinID: ACS62081
UniProt: C6BEC1
Position
1:complement(808118..808564)
AA seq 148 aa
MAVLKNKLKQLENGNYVDNSGNEIKATEFLNVLIPKKLKWTRGDYIVGLQESFIQLSKLG
LTGEQWNVLTYLIGKTDFENYIHITQKEISEHLGIKQQNVSKALKVLVDKEVIKKLKQGT
SNYYLFNPEIIYKGKSKNYDNVIDLFRE
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcagtcttgaagaataaattgaagcagttagaaaatggaaattatgtagacaattca
ggaaacgagatcaaagcaaccgaatttctgaatgtcctaataccaaaaaaactgaaatgg
acaagaggagattatatcgtgggcttacaagagagttttattcaactatcaaaacttggt
ctaactggcgaacaatggaatgttttgacctaccttattggcaaaactgattttgagaat
tacatacacataactcaaaaagaaatcagtgaacaccttggaattaaacaacagaatgta
tcgaaggctctaaaagtgcttgtcgataaagaagtaatcaagaaactcaaacaaggaact
tctaattactatcttttcaaccccgagataatttacaaaggcaagagcaagaattatgac
aatgttattgatttgttcagagaataa

DBGET integrated database retrieval system