KEGG   Ralstonia pickettii 12D: Rpic12D_0782
Entry
Rpic12D_0782      CDS       T00925                                 

Definition
(GenBank) mobilisation protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: MobC
Other DBs
NCBI-ProteinID: ACS62083
UniProt: C6BEC3
Position
1:complement(810340..810663)
AA seq 107 aa
MAKEKLEREVHIRLTQSDFALVQSKATDLGFSKQSDYLRALLKQEDKYSSLYRYLIYEFK
KQGNNLNQVAHKVNSVNPFLISTEIVNSLTEIERTYKAILDEIRSLK
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcaaaagaaaaactagaacgagaagttcatatcaggttaactcaatcagattttgcc
ttggttcagtcaaaagcgactgatctaggcttctcaaaacagagcgattatttaagagct
ctactcaaacaagaagataaatattcgagtttgtatcgctatttaatttacgaattcaag
aaacaaggaaacaaccttaaccaagttgcccacaaggtcaactctgtcaatccattttta
atcagcactgaaatagtaaattctctcaccgagatcgagagaacttacaaagcgatttta
gatgaaattcggagcttgaaatga

DBGET integrated database retrieval system