KEGG   Ralstonia pickettii 12D: Rpic12D_0783
Entry
Rpic12D_0783      CDS       T00925                                 

Definition
(GenBank) integrase family protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Phage_integrase GerE DUF1722
Other DBs
NCBI-ProteinID: ACS62084
UniProt: C6BEC4
Position
1:complement(810961..812358)
AA seq 465 aa
MATKLPRGVRLATWKNKDGTSTTKYRVEIKRKGWKGETNKLFDSLQEAVSYLALSKLKKG
QELLYSISEEERIKKNVELQQGTNKDFSFGFFAQKYLEDYVFNQPADTELKRRNQAMKKA
FITKICNISIVDRYLTPEEKDEMGLEKDEIVYRFFKGFDVRTQIKPIDINNYIKTRLKGD
KVNRAVKPVSVVREITFISNVFNKLIHFDESLEDIRNPTRDYDKSLLQNVVNVRKRVLSD
QEEEKFLEVINGYSNKQLADICKISLLTSMRRSEIVFLKKDQIRDDFKYIHLPITKSKKS
RDVYLDETAREFFRQLQPAEKAKDGRFFTYSNSGFGKVFADLMKRNGLENIHFHDLRRTK
ISRMLSIGGDKNTILIAKLLGFQSVRKFEDIHLTEKHKGIETQEAMLSTFGHGNIDTNYK
HYFNPVLSEVDKIERMRFLKEKKKVDNLTPQENDELLSLLIELTN
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggctacaaaactgccccgtggtgtccgtctagctacttggaagaacaaggacggtaca
agtaccaccaagtatagagtcgagatcaagagaaagggttggaaaggtgaaacgaacaaa
ctgttcgatagccttcaagaagcagtttcctatcttgctttaagcaagttaaagaaaggt
caggagcttttatattcaatctccgaagaagaacgaattaaaaagaatgtagaactccaa
caaggaacaaacaaggatttttcgtttggtttcttcgctcaaaaatacttggaagattat
gttttcaatcagcctgctgatactgaattgaaacgacgaaaccaagcaatgaaaaaagcc
tttatcacgaagatttgtaatatttctatcgtagatcggtatttaaccccagaagaaaaa
gacgaaatgggtttggaaaaagacgagatagtttaccgattcttcaaaggctttgatgtt
agaactcaaataaagcctatcgatataaacaactatatcaagactcgattaaaaggcgac
aaggtcaaccgtgctgtaaaacctgttagtgtcgtcagagaaattacttttatctccaat
gtatttaacaaactcattcattttgatgaatcactggaagatataaggaacccaacccga
gactatgataaatcccttcttcaaaatgtagtcaatgtcagaaaaagggttttatcagat
caagaagaagagaaatttttggaagtgatcaacggatattcaaataaacagcttgctgat
atttgtaaaatttccttgcttacttcaatgagaagatctgaaatcgtctttctgaaaaaa
gaccagataagagacgattttaaatacattcacctaccgattactaaatccaagaagtcc
agagatgtctatttagacgaaacagcaagagaattttttaggcaactacaaccagcagag
aaagcaaaagacggtcgatttttcacctattcaaattctggttttggaaaagtctttgct
gatttaatgaaaagaaatggattagaaaacattcattttcacgatttaagaagaaccaaa
atttcaagaatgctctcgataggtggagataaaaatacgattttgattgcgaaactttta
ggttttcaatcagtcaggaagttcgaagacatacacctaacagagaaacataaaggaatc
gaaacccaagaagctatgttaagcaccttcggacacggcaacatagacaccaactacaag
cattattttaatcccgttttaagtgaagtcgataagattgaacggatgagatttttgaaa
gagaagaagaaagtcgacaatttaaccccacaagaaaacgacgagcttctatcacttctt
atcgaactaaccaactaa

DBGET integrated database retrieval system